KEGG   Mus musculus (mouse): 97541
Entry
97541             CDS       T01002                                 

Gene name
Qars, 1110018N24Rik, 1200016L19Rik, C80286, GLNRS, Qars1
Definition
(RefSeq) glutaminyl-tRNA synthetase
  KO
K01886  glutaminyl-tRNA synthetase [EC:6.1.1.18]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00970  Aminoacyl-tRNA biosynthesis
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    97541 (Qars)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mmu01007]
    97541 (Qars)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    97541 (Qars)
Enzymes [BR:mmu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.18  glutamine---tRNA ligase
     97541 (Qars)
Amino acid related enzymes [BR:mmu01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   97541 (Qars)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    97541 (Qars)
 Prokaryotic type
   Other AARSs
    97541 (Qars)
Motif
Pfam: tRNA-synt_1c tRNA_synt_1c_R1 tRNA-synt_1c_C tRNA_synt_1c_R2
Other DBs
NCBI-GeneID: 97541
NCBI-ProteinID: NP_598555
MGI: 1915851
Ensembl: ENSMUSG00000032604
Vega: OTTMUSG00000034113
UniProt: Q8BML9
Position
9; 9 F2
AA seq 775 aa
MATPDSLALFTGLGLSENKARETLKNEALSTQLREAATQAHQILGSTIDKATGVLLYDLV
SRLRDTRRRSFLVSYIANKKIHTGLQLSAALEYVRSHPQDPIDTKDFEQECGVGVVVTPE
QIEEAVESTINKHQLQLLAERYRFNMGLLMGEARAALRWADGKMIKNEVDMQVLHLLGPK
MEADLVKKPKVAKARLEETDRKTAKDVVEKGEVAGQTLSLMEQLRGEALKFHKPGENYKT
PGYVITPYTMDLLKQHLEITGGQVRTRFPPEPNGILHIGHAKAINFNFGYAKANNGICFL
RFDDTNPEKEEAKFFTAIYDMVTWLGYTPYKVTYASDYFDQLYAWAVELIHGGLAYVCHQ
RVEELKGHNPLPSPWRDRPKEESLLLFEAMRKGKFAEGEATLRMKLVMEDGKMDPVAYRV
KYTPHHRTGDKWCIYPTYDYTHCLCDSIEHITHSLCTKEFQARRSSYFWLCNALKVYCPV
QWEYGRLNLHYAVVSKRKILQLVAAGAVRDWDDPRLFTLTALRRRGFPPEAINNFCARVG
VTVAQTTMEPHLLEACVRDVLNDAAPRAMAVLEPLQVVITNFPAPKPLDIRVPNFPADET
KGFHQVPFASTVFIERSDFKEESEPGYKRLASGQPVGLRHTGYVIELQNIVRGSSGCVER
LEVTCRRADAGEKPKAFIHWVSQPLVCEIRLYECLFQHKNPEDPVEVPGGFLSDLNPASL
QVVEGALVDCSVALAKPFDKFQFERLGYFSVDPDSHQGQIVFNRTVTLKEDPGKI
NT seq 2328 nt   +upstreamnt  +downstreamnt
atggctactccagattcgctagcgctgttcaccggccttggccttagcgagaacaaggcc
cgcgagacgctcaagaacgaggctctgagcactcagctgcgcgaggcggcgacccaggca
caccagattctgggttctaccatcgacaaggctactggggtcctcctatatgacttggtc
tcccgactcagggatactcggcgtcgttctttccttgtgagctatatagccaataagaag
attcacacgggactccagctgagcgctgctcttgaatatgttcggagtcatccccaggat
cccattgataccaaggacttcgagcaggagtgtggcgtcggtgtggtggtgacaccggag
cagattgaggaagctgtggagtccaccataaataagcatcagttgcagctcctagcggaa
cggtaccgtttcaacatggggctgctaatgggagaggctcgggctgcgctcagatgggca
gacggcaaaatgatcaagaacgaggtggatatgcaggtgcttcaccttttggggcccaag
atggaagctgatctggtgaagaagcccaaggtggcaaaggcacggctggaagaaacagac
cggaagacagcaaaagatgtggtggagaaaggtgaagtggctggccagaccctgtctctg
atggagcagctccggggggaggcacttaagtttcataagccaggtgagaactacaagacg
ccaggctatgtgatcactccatataccatggatctgctgaagcagcacctggagatcact
gggggacaggtacgtacgcggttccctccagagcccaatggaatcctgcatattggacac
gccaaagccatcaatttcaactttggttatgccaaggccaacaatggtatctgttttctg
cgctttgatgacaccaaccctgagaaagaagaagcaaaattcttcactgctatttatgac
atggtgacctggctgggttatacaccttacaaagtgacatatgcttctgactattttgac
cagctgtatgcctgggccgtggaactcatccatgggggtcttgcttatgtgtgtcaccag
agagtggaagagctcaaaggccataaccctttaccttctccatggagggacaggcctaag
gaagaatcattgctgctctttgaggcaatgcgcaagggcaaatttgcagaaggagaggcc
acacttcgaatgaagttggtgatggaagatggcaagatggaccccgtggcctatcgagtc
aagtacacgccacaccatcgcacaggggacaaatggtgcatctaccccacctatgactac
acacattgtctgtgtgactccattgagcacattacccactcgttgtgtaccaaggagttc
caggctcgacggtcttcctacttttggttatgtaacgctctgaaagtctattgtcctgtt
cagtgggaatatggtcgcctcaatttgcactatgctgttgtctcaaagcgcaagattctc
cagcttgtagcagctggtgctgttcgggactgggacgatccacggctcttcacactcact
gccctacgacgacggggttttccaccagaggctatcaacaacttctgtgctcgggttggg
gtcacagtggcacagaccacaatggaacctcatcttctggaagcctgtgtgcgtgatgtg
ctgaatgatgcagccccacgtgccatggctgttctagagccactacaagttgtcatcacc
aactttcctgctcccaagcccttggacatccgagtgccaaatttcccagctgatgagacc
aagggtttccaccaggttccttttgcttccactgtcttcattgagagaagcgactttaag
gaggagtcagaaccaggctataagcgcctagcttcgggccagcctgtgggcctgagacac
actggttatgtcattgaactgcagaatattgtcaggggctccagtggctgtgtggaacgc
ttggaggtgacctgtagacgagctgatgctggagagaagcccaaggcctttattcactgg
gtatcacagcctttggtgtgtgagattcgcctctatgagtgcctattccagcacaagaac
cccgaagaccctgttgaagtgcctggtggattcctaagtgacctgaacccggcgtcacta
caagtggtagaaggagcattagtggactgctctgtggctttggcaaagccctttgacaag
ttccagtttgagcgccttgggtacttctctgtggatccagacagccatcaaggacagatt
gtcttcaaccgaactgtcacactaaaagaagacccaggcaaaatatga

DBGET integrated database retrieval system