KEGG   Mus musculus (mouse): 97761
Entry
97761             CDS       T01002                                 

Gene name
Sgsm2, D630003G22Rik, R74628, Rutbc, Rutbc1, mKIAA0397
Definition
(RefSeq) small G protein signaling modulator 2
  KO
K21851  small G protein signaling modulator 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    97761 (Sgsm2)
Membrane trafficking [BR:mmu04131]
 Others
  Rab GTPases of specific organelles
   Melanosome
    97761 (Sgsm2)
Motif
Pfam: RUN PH_RBD RabGAP-TBC zf-BED
Other DBs
NCBI-GeneID: 97761
NCBI-ProteinID: NP_922934
MGI: 2144695
Ensembl: ENSMUSG00000038351
Vega: OTTMUSG00000006187
UniProt: Q80U12
Position
11; 11 B5
AA seq 1005 aa
MGSAEDAVKEKLLWNVKKEVKQIMEEAVTRKFVHEDSSHIIALCGAVEACLLHQLRRRAA
GFLRSDKMAALFTKVGKTCPVAEDICHKVQELQQQAEGRKPSGGSQEALRKQGSTGGKAP
ALSPQALKHIWVRTALMEKVLDRVVQYLAENCSKYYEKEALLADPVFGPILACLLVGPCA
LEYTKLKTADHYWTDPSADELVQRHRIRGPPNRQDSPAKRPALGIRKRHSSGSASEDRLA
ACAREYVESLHQNSRTRLLYGKNNVLVQPKEDMEAVPGYLSLHQSAENLTLKWTPNQLMN
GTLGDSELEKSVYWDYALVVPFSQIVCIHCHQQKSGGTLVLVSQDGIQRPPLHFPQGGHL
LSFLSCLENGLLPRGQLEPPLWTQQGKGKVFPKLRKRSSIRSIDVEELGVGRATDYVFRI
IYPGHRHEHNAGDMIEMQGFGPSLTAWHLEPLCSQGSSCLSCSSSSSPYATPSHCSCIPD
RLPLRLLCESMKRQIVSRAFYGWLAYCRHLSTVRTHLSALVHHNIIPPDRPPGASGGLTK
DVWSKYQKDEKNYKELELLRQVYYGGVEHEIRKDVWPFLLGHYKFGMSKKEMEQVDTAVA
ARYQQVLAEWKACEVVVRQREREAHPATLTKFSSGSSIDSHVQRLVHRDSTISNDVFISV
DDLEPSGPQDLEDSKPKREQEPGAGTPGIAAAEQQSVEFDSPDSGLPSSRNYSVASGIQS
SLDEAQSVGFEDDGAGEDGSEGPATAAHTFPGPHDPGQETLAPASELEAGQELAAVCAAA
YTIELLDTVALNLHRIDKDVQRCDRNYWYFTTSNLERLRDIMCSYVWEHLDMGYVQGMCD
LLAPLLVILDNDQLAYSCFSHLMKRMGQNFPSGGAMDSHFANMRSLIQILDSELFELMHQ
NGDYTHFYFCYRWFLLDFKRELLYEDVFAVWEVIWAARRISSEHFVLFIALALVEAYREI
IRDNNMDFTDIIKFFNERAERHDAQEILRIARDLVHKVQMLIDNK
NT seq 3018 nt   +upstreamnt  +downstreamnt
atgggcagcgcagaggacgcggtcaaagaaaagctgctgtggaacgtgaagaaggaggtg
aaacaaatcatggaggaggctgtcaccaggaaattcgtgcatgaagatagcagccacatc
attgctctgtgtggtgctgtggaggcttgcctcctgcatcagctaagacgccgtgctgct
ggctttctgcgaagtgacaagatggcggccctgttcaccaaagtggggaagacatgcccc
gtggctgaagatatctgccacaaggtgcaggagttgcagcaacaggcagagggcaggaaa
ccctcgggaggcagccaagaagcccttcggaaacagggctctaccggtgggaaggcccca
gctctcagcccacaggccttgaaacacatatgggtacgcacagcactcatggagaaagtt
ctggacagggttgtacagtacctggccgaaaactgcagcaagtattacgagaaggaagca
ttattggcagatcctgtgtttggcccaatcctggcatgtctcctagtgggaccctgtgcc
ttggaatacacgaagctcaagacagctgatcactactggactgacccctctgctgatgag
ctggttcagaggcaccgtatccggggtccccctaaccgtcaggactccccggcaaagcgc
cctgccctggggatccggaagcgccactctagtgggagtgcctcagaagaccggcttgcc
gcctgcgcccgtgagtacgtggagtctctgcaccagaactcaagaacacgcctgctctat
ggcaagaacaacgtgttggtgcagccgaaggaggacatggaggcagtccctggctacctc
tccctgcaccagtctgcagagaacctaaccctgaagtggactcccaaccaactcatgaac
gggactctcggggactctgagctagagaagagtgtttactgggactatgccttggtggtg
cccttcagtcagatcgtctgcatccactgccaccagcaaaagagcggtggcacgcttgtg
ctggtgagccaggatggcatccagaggccgccactacacttcccacagggaggacacctg
ctgtccttcctgtcatgtctggagaatgggctgctgcctcgtggacagcttgagcccccg
ctgtggacccagcagggaaagggcaaggttttccccaagctacggaaacgcagcagcatt
cggtccattgatgtagaggagctgggtgtcggacgggcaacggactacgtgttccggatc
atctaccccggacataggcacgagcataatgctggcgacatgattgagatgcagggtttc
ggacccagcctaacagcctggcacctagagcccctgtgtagccagggctcctcctgcctt
tcctgttcctccagtagctccccatatgcaacccccagtcactgcagctgcattcctgac
aggttgcccctccggctgctgtgtgagagcatgaagaggcagattgtgtcccgggccttc
tacggctggctagcctactgtcgccacctgtccacagtgaggacacacctgtctgcattg
gtgcatcacaacatcattccaccagacaggcccccgggggcctcaggtggcctcaccaag
gatgtgtggagcaagtatcagaaggacgaaaagaactacaaggagctggagctgctgcgg
caggtgtactatggaggcgtggaacacgagattcgcaaggacgtctggcccttcctactt
ggccactacaagtttggcatgagcaagaaggagatggagcaggtggatacagcagtggca
gcaaggtaccagcaggtgttggcagagtggaaggcctgcgaggtggtggtgaggcagcgg
gagcgggaggctcacccagccacgctcaccaagttctcctcgggcagcagcatcgatagc
cacgtgcagcgcctcgtgcaccgggattccaccatcagcaatgatgtatttatctctgtg
gatgatcttgagccctctggacctcaggacctggaagattccaaaccaaagcgggaacag
gagccaggagctgggaccccgggcatagcagctgcagagcagcagtctgtggagtttgac
tctccagactcagggctgccttcctcccgcaactactctgtggcctcaggcatccagtcc
agcctagatgaggcacagagtgtgggctttgaagacgacggtgctggagaagatggctcc
gagggtccagccactgcagcccacactttcccgggaccccacgatccaggccaggagacg
cttgcacctgccagtgagcttgaagcaggccaggagctcgcagctgtgtgcgccgcagcc
tatactatagaattactggacaccgtggccttaaatctgcaccgcatagacaaggatgtg
cagagatgtgaccgcaactactggtacttcacgacctccaacctcgagaggctcagagac
atcatgtgcagctacgtgtgggagcacctggatatgggctacgtgcagggcatgtgtgat
ctcctggcacctctcctggtcatccttgacaatgaccagctggcctacagctgcttcagc
cacctcatgaagaggatgggccagaacttccccagtgggggtgccatggacagccacttt
gccaacatgcgctccctcatccagatcttggactcagagctatttgagctgatgcatcaa
aatggagactatacccacttctatttctgttatcgctggttcctgctggattttaaaaga
gagctgctgtatgaggacgtgtttgcagtgtgggaagtgatctgggcagccaggcgcatc
tcctcagagcactttgtcctgttcatcgccctggccctggtggaggcctacagagagatt
atccgtgacaacaacatggacttcaccgacatcatcaaattcttcaacgagcgggctgag
cggcatgatgcccaggagatcctgcggattgcccgggacttggtccacaaggtgcagatg
ctcatagacaacaagtga

DBGET integrated database retrieval system