KEGG   Mus musculus (mouse): 97908Help
Entry
97908             CDS       T01002                                 

Gene name
H3c8, H3.1-221, H3c1, H3c10, H3c11, Hist1h3g, M32460
Definition
(RefSeq) H3 clustered histone 8
  KO
K11253  histone H3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05034  Alcoholism
mmu05202  Transcriptional misregulation in cancer
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    97908 (H3c8)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    97908 (H3c8)
  09165 Substance dependence
   05034 Alcoholism
    97908 (H3c8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    97908 (H3c8)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    97908 (H3c8)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    97908 (H3c8)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   97908 (H3c8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-S CENP-T_C PAF CBFD_NFYB_HMF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 97908
NCBI-ProteinID: NP_659539
MGI: 2145541
Ensembl: ENSMUSG00000099517
Vega: OTTMUSG00000000570
UniProt: P68433
Structure
PDB: 

Position
13; 13 A3.1
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtactaagcagaccgctcgcaagtctaccggcggcaaggccccgcgcaagcag
ctggccaccaaggccgcccgcaagagcgccccggccaccggcggcgtgaagaagcctcac
cgctaccgtcccggcactgtggcgctgcgcgagatccggcgctaccagaagtcgaccgag
ctgctgatccgcaagctgccgttccagcgcctggtgcgcgagatcgcgcaggacttcaag
accgacctgcgcttccagagctcggccgtcatggctctgcaggaggcctgtgaggcctac
ctcgtgggtctgtttgaggacaccaacctgtgcgccatccacgccaagcgtgtcaccatc
atgcccaaggacatccagctggcccgtcgcatccgcggggagagggcttaa

DBGET integrated database retrieval system