KEGG   Mus musculus (mouse): 98053Help
Entry
98053             CDS       T01002                                 

Gene name
Gtf2f1, 2810405L04Rik, C76800, RAP74
Definition
(RefSeq) general transcription factor IIF, polypeptide 1
  KO
K03138  transcription initiation factor TFIIF subunit alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    98053 (Gtf2f1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    98053 (Gtf2f1)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIF
     98053 (Gtf2f1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIIF_alpha
Motif
Other DBs
NCBI-GeneID: 98053
NCBI-ProteinID: NP_598562
MGI: 1923848
Ensembl: ENSMUSG00000002658
UniProt: Q3THK3
Position
17; 17 D
AA seq 508 aa AA seqDB search
MAALGSSSQNVTEYVVRVPKNTAKRYNIMAFNAADKVNFATWNQARLERDLSNKKIYQEE
EMPESGAGSEFNRKLREEARRKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTE
NTAYYIFTQCADGAFEAFPVQNWYNFTPLARHRTLTAEEAEEEWERRNKVLNHFSIMQQR
RLKDQDQDEDEEEKEKRSRKKPSELRIHDLEDDLEMSSDASDASGEEGSRTSKAKKKAPV
TKAGRKKKKKKGSDDEAFEDSDDGDFEGQEVDYMSDGSSSSPDETEGKPKVPQQEDGPKG
VDEQSESSEESEEEKPPEEDKEEEEEKKAPTPQEKKRRKDSSDDSDSSEESDIDSETSSA
LFMAKKKTPPKRERKPSGGSSKGTSRPGTPSAEAASTSSTLRAAASKLEQGKRTSETPAA
KRLRMDTGPQSLSGKSTPSSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQT
VNVLAQILKRLNPERKMIGDKMHFSLKE
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggcggctctaggctccagcagccagaatgtcaccgagtacgtcgtccgagtccccaag
aacacagccaaaagatacaacataatggcttttaatgcagccgataaagtcaactttgct
acctggaaccaggcacggctggagcgagatctgagcaacaagaagatttaccaggaagaa
gagatgccagagtccggtgcaggcagtgaattcaaccgcaagcttagggaggaggcgcgc
cggaagaagtatggcattgtcctaaaggagtttcggcctgaggaccagccttggctactc
cgtgtcaatggcaaatcaggacggaagttcaaaggcattaagaaaggcggggtaacagag
aacacagcctactacatcttcacacagtgtgctgatggtgcctttgaggctttccctgta
cagaactggtacaatttcacaccactggcccgacaccgcacactcactgctgaggaagcc
gaggaggaatgggagaggaggaacaaggtcctaaaccacttcagcatcatgcagcagcgg
cggctcaaggaccaggaccaggatgaagatgaggaggagaaggagaagcgcagtcgcaag
aagcctagtgagctgcgcattcatgacctggaggatgacctggaaatgtcctccgatgcc
agcgatgccagtggtgaagagggcagcagaacctccaaggctaagaaaaaggcccctgtg
accaaggcaggcaggaagaagaaaaagaagaagggctcagatgatgaggcttttgaggac
agcgatgatggggacttcgagggccaggaggtagactacatgtctgatggctccagcagc
tctccagatgagacagaaggcaagcccaaagtgccccagcaggaggatggcccaaagggg
gtggatgagcagagcgagagcagtgaggagagtgaggaggagaagccccccgaggaggac
aaggaggaggaagaagagaagaaggcccctaccccacaagagaagaagcgcaggaaagac
agcagtgatgactcagacagctcagaagagagcgacattgacagtgagacctcctctgca
ctcttcatggcgaagaagaagacacccccaaagagggagcggaagccatcgggggggagt
tcaaagggcaccagtcggccagggactcccagtgcagaagcagcaagcacctcttctacc
ctgcgggctgcagccagcaagctggagcaggggaagcggacgagtgagactccagcagcc
aagcgtcttcggatggacacgggtccccagagcctgtctgggaagtccacacccagcagc
ggtgatgtccaggtgacagaggacgctgtgcgccgctacctgacccgcaagcccatgacc
acaaaggacctgctgaagaagttccagaccaagaagacagggctgagcagcgagcagaca
gtaaatgtgctggcgcagatcctcaagcgcctcaaccctgagcgcaagatgattggtgat
aagatgcacttctccctcaaagagtga

DBGET integrated database retrieval system