KEGG   Mus musculus (mouse): 98221
Entry
98221             CDS       T01002                                 

Symbol
Eif3m, Ga1, Ga17, Pci, Pcid1, Tan, Tango7
Name
(RefSeq) eukaryotic translation initiation factor 3, subunit M
  KO
K15030  translation initiation factor 3 subunit M
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mmu03012]
    98221 (Eif3m)
Translation factors [BR:mmu03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    98221 (Eif3m)
SSDB
Motif
Pfam: PCI eIF3m_C_helix Death
Other DBs
NCBI-GeneID: 98221
NCBI-ProteinID: NP_663355
MGI: 1351744
Ensembl: ENSMUSG00000027170
Vega: OTTMUSG00000014975
UniProt: Q99JX4
Position
2 E2; 2 55.06 cM
AA seq 374 aa
MSVPAFIDISEEDQAAELRAYLKSKGAELSEENSEGGLHVDLAQIIEACDVCLKEDDKDV
ESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVR
YTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWKLTTEKKHTLLRLLYEALVDCKKSDA
ASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDL
LTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQE
LQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQN
LNKVKNSLLSLSDT
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgagcgtcccggccttcatcgatatcagcgaggaagaccaggctgctgaacttcgagct
tatctgaaatcaaaaggagctgagctctcagaagaaaactcggaaggtggacttcatgta
gatttagctcagattattgaagcctgtgatgtgtgtctgaaggaagatgataaagatgtt
gaaagtgtgatgaacagtgtggtgtccctcctgttgatcctggaaccagacaagcaagaa
gcattgattgaaagtctgtgtgaaaagctggtcaagtttcgggaaggcgaacgcccatct
ctgagactacagttgctcagcaaccttttccatgggatggacaagaatactcctgtgagg
tacacagtgtactgcagcctcatcaaagtggcggcatcatgtggggccatccagtacatc
ccaacggagctggatcaagtgagaaagtggatctctgactggaagctcaccactgaaaag
aagcacaccctcctcagactgctctacgaggcgctcgtggattgtaagaaaagtgatgct
gcatcaaaggtcatggtggaattgctcgggagttacacagaggacaatgcttcccaggct
cgagttgatgcccacaggtgtattgtgcgggcactaaaggatccaaatgcctttcttttt
gaccatcttcttactctaaagccagtcaaatttttggaaggcgagcttatccatgattta
ttaaccatttttgtgagtgctaaattggcatcgtatgtcaagttctatcagaataacaaa
gacttcatagattcacttggcttgttacatgagcaaaatatggcgaaaatgagactcctc
acctttatgggaatggcagtggaaaacaaagagatttcttttgacacaatgcagcaagag
ctacagattggagctgatgatgttgaagcatttgttattgatgctgtaagaactaaaatg
gtctactgcaaaattgatcagacccaaagaaaagtagttgtcagtcacagcacacatcgg
acatttggaaaacagcagtggcaacaactgtatgacactcttaatgcctggaaacagaac
ttgaacaaagtgaaaaatagccttttgagtctttcagatacctga

DBGET integrated database retrieval system