KEGG   Mus musculus (mouse): 98258
Entry
98258             CDS       T01002                                 

Gene name
Txndc9, AI098020, APACD, Ap
Definition
(RefSeq) thioredoxin domain containing 9
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: Thioredoxin Phosducin
Other DBs
NCBI-GeneID: 98258
NCBI-ProteinID: NP_742051
MGI: 2138153
Ensembl: ENSMUSG00000058407
Vega: OTTMUSG00000026595
UniProt: Q9CQ79
Position
1; 1 B
AA seq 226 aa
MEGNGSVDMFSEVLENQFLQAAKLVENHLDSEIQKLDQIGEDELELLKEKRLAALRKAQQ
QKQEWLSKGHGEYREIGSERDFFQEVKESEKVVCHFYRDTTFRCKILDRHLAILAKKHLE
TKFLKLNVEKAPFLCERLRIKVIPTLALLRDGKTQDYVVGFTDLGNTDDFTTETLEWRLG
CSDVINYSGNLMEPPFQSQKKFGTNFTKLEKKTIRGKKYDSDSDDD
NT seq 681 nt   +upstreamnt  +downstreamnt
atggaaggtaatggatccgtcgacatgttctcagaagtcctggagaaccagttcctccag
gccgctaagctggtggagaatcacttggactctgaaattcagaaactggatcagattggt
gaagatgaactggagctgctcaaagaaaagaggctggcggcgctcaggaaggctcagcag
cagaaacaagagtggctttccaaagggcacggggagtacagagaaatcggcagcgagaga
gacttctttcaagaggtcaaggagagtgagaaagtggtttgccatttctacagagacacc
acattcaggtgtaaaatactagacagacatttggcaattctggccaaaaagcatcttgaa
accaagtttttgaagctgaatgtggaaaaggcaccattcctctgtgagagactgcggatc
aaggtcatccccacgctagctctcttaagagatggcaagacgcaagattatgttgttgga
ttcaccgacctaggaaatacagatgacttcactacagaaactttagaatggagacttggt
tgttctgatgttatcaattacagtggaaatttaatggagccaccatttcagagccaaaag
aaatttgggacaaactttacaaagctggaaaagaaaactatccgaggaaagaaatacgat
tccgattctgatgatgactag

DBGET integrated database retrieval system