KEGG   Mus musculus (house mouse): 98267
Entry
98267             CDS       T01002                                 
Symbol
Stk17b, 3110009A03Rik, Drak2
Name
(RefSeq) serine/threonine kinase 17b (apoptosis-inducing)
  KO
K08804  serine/threonine kinase 17 [EC:2.7.11.1]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    98267 (Stk17b)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     98267 (Stk17b)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  DAPK family
   98267 (Stk17b)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kinase-like Pkinase_fungal Kdo YrbL-PhoP_reg RIO1
Other DBs
NCBI-GeneID: 98267
NCBI-ProteinID: NP_598571
MGI: 2138162
Ensembl: ENSMUSG00000026094
UniProt: Q8BG48
Position
1:complement(53794671..53824374)
AA seq 372 aa
MSRRRFDCRSVSGLLTTTPQTPIKTENFNNFYTLTPKELGRGKFAVVRQCISKSTGQEYA
AKSLKKRRRGQDCRAEILHEIAVLELARSCPHVINLHEVYENATEIILVLEYAAGGEIFN
LCLPELAEMVSENDVIRLIKQILEGVHYLHQNNIVHLDLKPQNILLSSIYPLGDIKIVDF
GMSRKIGNASELREIMGTPEYLAPEILNYDPITTATDMWNIGIIAYMLLTHTSPFVGEDN
QETYLNISQVNVDYSEEMFSSVSQLATDFIQSLLVKNPEKRPTAESCLSHSWLQQWDFGS
LFHPEETSGSSQIQDLTLRSSEEKTSKSSCNGSCGAREDKENIPEDGSLVSKRFRFDDSL
PSPHELVPDLFC
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgtctcggaggagattcgattgccgaagtgtctcaggcttgctaactacaacccctcaa
acgccgattaaaacagagaattttaataatttctatactcttaccccaaaagaacttggg
agaggaaaatttgctgtggttagacaatgtatatcaaaatcaactggacaagagtatgct
gccaaatccctgaaaaagaggagaagagggcaggattgccgggcggaaattctgcatgag
atagctgtgctggagctggccaggtcttgtccccacgtgattaatctgcatgaggtctac
gaaaatgcaacggaaatcattttggtgttagaatatgctgcgggtggagaaattttcaac
ctgtgtttacctgagttagccgaaatggtatctgaaaatgatgttatcagactcattaaa
caaatccttgaaggagttcattatctacatcagaataacattgttcaccttgatttaaag
ccacagaatatacttttgagcagtatatacccactcggggacataaaaattgtagatttt
ggaatgtctcgaaaaattgggaatgcaagtgagcttcgggaaatcatgggaacacctgaa
tacttagctccagaaatcctcaactatgatcccattaccacagcaacagatatgtggaat
attggcataatagcgtatatgttgttaactcatacatcaccatttgtaggagaagataat
caagaaacatatctgaatatttctcaagtgaatgtagattattcagaagaaatgttttca
tcagtttcacagctggccacagacttcatccagagccttctagtaaagaacccagagaaa
agaccaacagcagaatcctgcctatcccactcatggctgcagcagtgggactttggaagc
ttgtttcatcctgaggaaacttcaggctcctctcaaattcaggatctgactctcaggtcc
tctgaagagaagacctccaagtcctcctgtaatgggagctgtggagcccgggaggacaag
gagaacatccctgaagatggcagcttagtttctaaaagatttcgattcgatgactccttg
cccagcccccatgaacttgttccagatttgttctgttag

DBGET integrated database retrieval system