KEGG   Mus musculus (house mouse): 98314
Entry
98314             CDS       T01002                                 
Symbol
D2hgdh, AA408776, AA408778, AI325464
Name
(RefSeq) D-2-hydroxyglutarate dehydrogenase
  KO
K18204  D-2-hydroxyglutarate dehydrogenase [EC:1.1.99.39]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    98314 (D2hgdh)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.99  With unknown physiological acceptors
    1.1.99.39  D-2-hydroxyglutarate dehydrogenase
     98314 (D2hgdh)
SSDB
Motif
Pfam: FAD-oxidase_C FAD_binding_4
Other DBs
NCBI-GeneID: 98314
NCBI-ProteinID: NP_849213
MGI: 2138209
Ensembl: ENSMUSG00000073609
UniProt: Q8CIM3
Position
1:93752539..93781579
AA seq 535 aa
MVLPLVSRWSARVLWASPGWRRTYTQRACVGLKRLGCPRGVYSPLAHRAYSVVAGGPEVT
LTPERYPVQRLPFSTVSEEDLAAFECIIPGRVITDPEQLQTCNVDWLKTVRGCSKVLLRP
QTSEEVSQILRHCYKRNLAVNPQGGNTGMVGGSVPVFDEVILSTALMNQVISFHDVSGIL
VCQAGCVLEELSRYVQERDFIMPLDLGAKGSCHIGGNVATNAGGLRFLRYGSLRGTVLGL
EVVLADGTILNCLTSLRKDNTGYDLKQMFIGSEGTLGVITAVSIVCPPRPKAVNVAFLGC
PGFAEVLQTFRTCRGMLGEILSAFEFMDTECMQLVGQHLQLTNPVQESPFYVLVETSGSS
AGHDAEKLTNVLEQVLNSGLVTDGTMATDQRKVQMLWALRERITEALSRDGYVFKYDLSL
PVERLYDLVIDLRTRLGPRAKHVVGYGHLGDGNLHLNVTAEAFSRELLGALEPYVYAWTA
EQRGSVSAEHGLGFKKKDVLGYSKPPVAVTLMQQLKAMLDPEGILNPYKTLPAQA
NT seq 1608 nt   +upstreamnt  +downstreamnt
atggtgctccctctggtgtccagatggtctgcaagggtcctctgggcatctccaggatgg
aggaggacctacacccagagagcttgtgtggggttgaagcggctgggttgccctcggggt
gtgtacagccccttggctcacagagcatactccgtggtagctggcggcccagaggtgacg
ctgacccctgagcgatatccggtgcaacggctgccgttttctactgtgtccgaggaggac
ctggctgcatttgaatgcatcatacctggcagagttatcacagatccagagcaactgcag
acatgcaacgttgactggctgaagaccgtccggggttgtagtaaggttttgctgagaccc
cagacctcagaggaagtctcccagattcttaggcactgctataagaggaacttggctgtg
aacccacagggcgggaacactggcatggtgggtggcagtgttcctgtctttgacgaagtc
atcctgtccactgccctcatgaatcaagtcatcagctttcatgatgtatctggaatcctg
gtttgccaggcaggctgtgtgctggaggagctgagcaggtacgtgcaggagcgggacttc
atcatgccactggacttgggagcaaagggcagctgccacatcgggggaaatgtggcaaca
aatgctggtggcctgcgattcctgagatatggctcccttcgagggactgtcctgggcctg
gaagtggtactcgctgatgggaccatcctgaactgcctgacatctctgaggaaggacaac
acaggctatgacctgaagcagatgttcattgggtcagagggcaccctaggagtcatcact
gctgtgtccattgtgtgcccacccaggcctaaggctgtgaatgtggctttccttggctgc
cctgggtttgctgaggttctgcagaccttccgcacctgcagggggatgctgggtgagatc
ctgtctgcctttgagttcatggatactgaatgcatgcagttggttggacagcacctccag
ctgaccaacccagtacaagagagtccattctatgtcctggttgagacctcaggctccagt
gcaggacatgatgctgagaagctgacgaacgtcctggagcaggtgctgaactctggcctg
gtgacagatggcactatggccaccgaccagaggaaagtccagatgctatgggccttgcgg
gagaggatcacagaggcactcagccgagatggctatgtgttcaagtatgacttatctctc
cctgtggagcggctctacgaccttgtgatcgacctacgcacccgccttggcccccgtgcc
aagcacgtggtgggatatggacacctgggggatggcaaccttcacctgaacgtgacagca
gaggcctttagccgggagttgctcggtgccttggaaccttatgtgtatgcctggacagcg
gagcagcggggcagtgtcagtgcggagcacggcctgggcttcaagaagaaggatgtactt
ggctatagcaagccacctgtggccgtgacgcttatgcaacagctcaaggccatgctggac
cccgaaggcatcctgaacccctataagactctacctgcccaggcctaa

DBGET integrated database retrieval system