KEGG   Mus musculus (mouse): 98363Help
Entry
98363             CDS       T01002                                 

Gene name
Efhd1, 4931430I01Rik, AI452351, PP3051, mitocalcin
Definition
(RefSeq) EF hand domain containing 1
  KO
K23921   
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 98363
NCBI-ProteinID: NP_083165
MGI: 1921607
Ensembl: ENSMUSG00000026255
Vega: OTTMUSG00000029545
UniProt: Q9D4J1
Position
1; 1 C5
AA seq 240 aa AA seqDB search
MSSEELACKLQRRLRLEVRAETDQGDPQPAPCDAPAGHPEPEPPARAPTASADSELNLKL
SRRLDIHQGTARPGRSKVFNPYTEFPEFSRRLLKDLEKMFKTYDAGRDGFIDLMELKLMM
EKLGAPQTHLGLKSMIKEVDEDFDGKLSFREFLLIFHKAAAGELQEDSGLLALAKFSEID
VALEGVRGAKNFFEAKAQALSCSSKFEAELKAEQEERKREEEARRLRQAAFRELKAAFSA
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcgaggagctggcctgcaagctgcagcgccggttgagacttgaggtgcgggca
gagaccgaccagggcgacccccagcctgcaccctgcgatgccccagccgggcacccggag
cctgaaccgcctgcccgggcgcccacagccagcgcggactccgaactgaacctcaagctg
agccgcaggctggacatccaccagggtacagcgcggccgggccgctctaaggtcttcaat
ccctacaccgagttcccggagttcagccgccgcctcctgaaggatctggagaagatgttc
aaaacgtatgatgctggaagggacggctttattgacctgatggagctgaaactcatgatg
gagaaactgggggcccctcagacccacctgggcctgaagagcatgatcaaggaggtggat
gaggacttcgacgggaagctcagcttccgggagttcctgctcattttccacaaggctgct
gctggtgagctgcaggaggacagtgggttgctggcactggccaagttttccgagattgat
gtcgccctggaaggtgtcagaggtgccaagaacttcttcgaagccaaggcccaggccttg
tcatgttccagtaagttcgaagctgagttaaaagctgagcaagaagagcggaaacgggag
gaggaggcccggaggctccgccaggcagccttccgggagctcaaggcagctttcagcgcg
tag

DBGET integrated database retrieval system