KEGG   Mus musculus (house mouse): 98366
Entry
98366             CDS       T01002                                 
Symbol
Smap1, 1700056O10Rik, 4921514B13Rik, 4921525H11Rik, AI462175
Name
(RefSeq) small ArfGAP 1
  KO
K12486  stromal membrane-associated protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    98366 (Smap1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    98366 (Smap1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    98366 (Smap1)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    98366 (Smap1)
SSDB
Motif
Pfam: ArfGap
Other DBs
NCBI-GeneID: 98366
NCBI-ProteinID: NP_082810
MGI: 2138261
Ensembl: ENSMUSG00000026155
UniProt: Q91VZ6
Position
1:complement(23883906..23961462)
AA seq 440 aa
MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGVFICIRCAGIH
RNLGVHISRVKSVNLDQWTPEQIQCMQDMGNTKARLLYEANLPENFRRPQTDQAVEFFIR
DKYEKKKYYDKNAIAITNKEKEKKKDEKKREKEPEKPAKPLTTEKLPKKEEQQLEPKKST
SPKNAAEPTIDLLGLDGPAEAPVTNGNPATAPALSDDLDIFGPMISNPLPAAVMPPAQGT
ASVPAPATLSTVTSGDLDLFTEQTTKSEEVAKKQLSKDSILSLYGTGAQQSTPGVFMGPT
NIPFTSQAPTAFQGFPSMGVPVPAAPGLIGNMMGQNTGMMVGMPMHNGFMGNAQTGVMPL
PQNVVGPQGGMVGQMGAPQSKFGLPQAQQPQWNLSQMNQQMAAMNLSSANASAGFGQPPS
TTAGWSGSSSGQTLSTQLWK
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggcgacacgctcctgtcgggagaaggctcagaagctgaacgagcagcaccagctcatc
ctgtccaaactgctgagggaggaggacaacaagtactgcgccgactgcgaggccaaaggt
ccccgatgggcttcctggaatattggtgtgtttatttgcatcagatgtgctggaattcat
agaaatcttggggttcatatatccagagtcaagtcagtcaacctagaccaatggacacca
gaacagatacagtgcatgcaagatatgggaaatactaaagcaagactactttatgaagcc
aatcttccagagaactttcgaagaccacagacagatcaagcagtagagtttttcatcaga
gataaatatgaaaagaagaaatactatgataaaaatgcaatagctatcacaaataaagaa
aaggaaaaaaaaaaggacgagaaaaagagagaaaaggagccagaaaagcctgcaaaacca
ctaacaacggaaaagctgccgaagaaagaagagcaacaacttgagcctaagaaaagcacc
agcccaaaaaatgctgcagagcccactattgatcttctaggacttgatggtcctgctgag
gcacccgtgaccaatggaaacccagccacagcgccagccctgagtgatgatctggacatt
tttggaccaatgatttctaaccctttacctgcagctgtcatgcccccggctcaggggact
gcctccgtaccagcacctgctaccctgtctaccgttacatctggggacctggatctgttt
actgagcaaactacaaagtcagaagaagtagcaaagaaacaactctccaaagactccatc
ttatctctgtatggtacaggagcacagcaaagcactcctggtgtgtttatgggacccaca
aatataccatttacctcacaagcaccgactgcatttcaaggttttccttccatgggcgtc
ccagtgcctgcagctcccggtcttataggaaatatgatgggacagaatactggcatgatg
gtgggcatgcccatgcacaatgggttcatgggaaacgcacagactggagtgatgccactt
cctcagaatgttgttggccctcagggaggaatggtgggacaaatgggtgcaccacagagt
aagttcggcttgccacaagcccagcagcctcagtggaacctctcacagatgaatcagcag
atggctgccatgaacctcagtagtgctaacgctagtgcaggttttggccagcctcccagc
acgacagcagggtggtctggaagctcatcggggcagacgctgagcacacagctgtggaag
taa

DBGET integrated database retrieval system