KEGG   Mus musculus (mouse): 98496
Entry
98496             CDS       T01002                                 

Gene name
Pid1, 5033414K04Rik, NYGGF4, P-CLI1
Definition
(RefSeq) phosphotyrosine interaction domain containing 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: PID_2 PID
Other DBs
NCBI-GeneID: 98496
NCBI-ProteinID: NP_001003948
MGI: 2138391
Ensembl: ENSMUSG00000045658
Vega: OTTMUSG00000040068
UniProt: Q3UBG2
Position
1; 1 C5
AA seq 217 aa
MWQPATERLQHFQTMLKSKLNVLTLKKEPIPAVLFHEPEAIELCTTTPLMKARTHSGCKV
TYLGKVSTTGMQFLSGCTEKPVIELWKKHTLAREDVFPANALLEIRPFQVWLHHLDHKGE
ATVHMDTFQVARIAYCTADHNVSPNIFAWVYREINDDLSYQMDCHAVQCESKLEAKKLAH
AMMEAFKKTFHSMKSDGRIHRSSSSEEASQELESDDG
NT seq 654 nt   +upstreamnt  +downstreamnt
atgtggcagccggctactgagcgcctgcagcacttccagaccatgctgaagtctaagttg
aatgtcctaacactgaaaaaggaacctataccagcagtcctcttccatgagccggaagcc
attgagctgtgcaccaccacacccctgatgaaggcaaggactcatagtggctgcaaggtt
acctatctgggaaaagtctctaccacaggcatgcagtttttgtctggttgcaccgagaag
ccagtcattgagctctggaagaaacacacactggctcgagaagatgttttcccggccaac
gccctcctagagatccggccattccaagtgtggcttcatcaccttgaccacaagggtgag
gcaacagtgcacatggataccttccaggtggctcgaattgcctactgcacagctgaccac
aacgtgagccccaacatcttcgcctgggtgtacagagagatcaatgatgacctctcttac
cagatggactgccatgcagtgcaatgtgagagcaagctggaggccaagaagctggcacac
gccatgatggaggcattcaagaagactttccacagtatgaagagtgatgggcggatccat
aggagcagctcatctgaagaggcttcccaggaattggaatctgatgatggctga

DBGET integrated database retrieval system