KEGG   Mus musculus (house mouse): 98558
Entry
98558             CDS       T01002                                 
Symbol
Mael, 4933405K18Rik
Name
(RefSeq) maelstrom spermatogenic transposon silencer
  KO
K18411  protein maelstrom
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    98558 (Mael)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Gene silencing
   piRNA pathway
    98558 (Mael)
SSDB
Motif
Pfam: Maelstrom HMG_box_2 HMG_box
Other DBs
NCBI-GeneID: 98558
NCBI-ProteinID: NP_780505
MGI: 2138453
Ensembl: ENSMUSG00000040629
Position
1:complement(166028954..166066313)
AA seq 434 aa
MPNRRASRNAYYFFVQEKIPELRRRGLPVARVADAIPYCSADWALLREDEKEKYSEMARE
WRAAQGKDSGPSEKQKLVSTPLRRPGMLVPKPSISPPDMSNLSIKSDQALLGGIFYFLNI
FSHGELPPHCEQRFLPCEIGCVKYSLQEGIMADFHSFIHPGEIPRGFRFHCQAASDSSHK
IPISNFEFGHDQATVLQNLYKFIHPNPGNWPPIYCKSDDRARVNWCLKRMERASEIRQDL
ELLTVEDLVVGIYQQKFLKEPSKTWVRSLLDVAMWDYSSNTRCKWHEENDILFCALAVCK
KIAYCISNSLATLFGIQLTGAHVPLQDYEASNSVTPKMVVLDAGRYQKLRVESPGFCHFN
SYNQEQRSNTSTGYYPSGVKISGPHSSVRGRGITRLLESISNSSNNIHRFSSCETSLSPY
TPQKDGYKPFSSFS
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgcccaaccgcagggccagccgcaatgcctactatttcttcgtacaggagaagattccc
gaactgcgccggcgaggcctgccggtggcccgcgtggcagacgccatcccctactgctcg
gccgactgggcgctcttgagggaggatgagaaggagaaatactcagaaatggctcgagag
tggagagcagcccagggaaaggattctgggccttcagagaagcagaaacttgtatctaca
ccactgaggaggccaggcatgcttgtaccaaaaccaagtatttctccccctgatatgtca
aatttatctataaaaagtgatcaagctctccttggaggcattttttattttctgaacatt
tttagccatggtgagctacctcctcattgtgaacagcgcttcctcccttgtgaaattggc
tgtgttaaatactccctccaggaaggtattatggcagatttccacagttttatccatcca
ggtgaaattccacgaggatttcgattccattgccaggctgcaagtgattctagtcacaag
attcctatttcaaactttgaattcgggcatgaccaagcaactgtgttacaaaacctctat
aaatttatacatccaaacccagggaactggccacctatttactgcaagtctgatgataga
gccagagtcaactggtgtttgaagcgtatggagcgggcatcagaaataaggcaagatcta
gaacttctcactgtagaggaccttgtagttgggatctaccagcaaaaattcctcaaggag
ccctctaagacctgggtgcgaagcctcctagatgtggccatgtgggactattctagcaac
acgaggtgcaaatggcatgaagaaaatgatattctcttctgtgctttagctgtttgcaag
aaaatcgcgtactgcatcagtaattctctagccactctgtttggaatccagctcactgga
gctcatgtaccactacaagactatgaggccagcaacagtgtgacacccaaaatggttgta
ttggatgcagggcggtaccagaagctaagagttgagagtccaggattctgtcatttcaac
tcttacaatcaggaacaaagatcaaatacatctactggttattatccatctggggtgaaa
atttcgggccctcacagcagtgttcgcggaagaggaattacccgcttactagagagcatc
tcaaactcctccaacaacatccatagattctccagctgtgagacttcactctcaccttac
acgccccaaaaagatgggtacaaacctttctcctccttttcttaa

DBGET integrated database retrieval system