KEGG   Mus musculus (mouse): 98682
Entry
98682             CDS       T01002                                 

Symbol
Mfsd6, 2210010L05Rik, 9630025I22Rik, AI836200, AW212394, MMR, MMR2
Name
(RefSeq) major facilitator superfamily domain containing 6
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: MFS_1_like MFS_1 Nuc_H_symport LacY_symp MFS_3 TMIE
Other DBs
NCBI-GeneID: 98682
NCBI-ProteinID: NP_835182
MGI: 1922925
Ensembl: ENSMUSG00000041439
Vega: OTTMUSG00000033382
UniProt: Q8CBH5
Position
1; 1 C1.1
AA seq 775 aa
MAADDKVAILTDDEEEQKRKYVLADPFNGICREPEPPSNETPSSTETSAIPEEEIDWIEK
HCVKVNNDLLISKVFYFFFYSAYGSLYPLLPVYYKQLGMSPSQSGLLVGIRYFIEFCSAP
FWGVVADRFRKGKIVLLFSLLCWVLFNLGIGFVKPATLRCLPKIPPTAHPTNVSHPVTVL
PMNSSTVAFFSTPPKLLQKRDVQLSETEPNISDIDLVSTALTLTSEPTRRPQTEAITHPV
TGLILNTSTVTLPPTGNVTRETTIAVVTTTKSLPSDQVTLVYDQQEVEAIFLIILVVVII
GEFFSASSVTIVDTVTLQYLGKHRDRYGLQRMWGSLGWGLAMLSVGIGIDYTHIDVLIDG
KGCKPPEYRNYQIVFIVFGVLMTMALIVATQFRFRYNHFNNSDGKGKEVEIPQVERDNST
ESSEETPTAATHSQAFNFWDLIKLLCSVQYGSVLFVAWFMGFGYGFVFTFLYWHLEDLNG
TTTLFGVCSVLSHVSELTAYFFSHKLIELIGHIRVLYIGLACNTARYIYISYLENAWTVL
PMEVLQGVTHAAIWAACISYLSAAVPPELRTSAQGILQGLHLGLGRGCGAMIGGVLVNYF
GAAATFRGIGMACLVILLLFALIQWLAVPDEEEDKTMLAERIPVPSSPVPIATIDLVQQQ
TEDVMPRVEARLPPKKTKHQEEQEDVNKPAWGVSSSPWVTFVYALYQVKELIQLTRESRA
SEIQPLQVTLCWASVASAPLLPPCSSKHMGNRKTGMLAKDISGLRSLCHSVYQVA
NT seq 2328 nt   +upstreamnt  +downstreamnt
atggctgctgatgataaagttgctatcctaactgatgatgaagaggagcagaagagaaaa
tatgtgcttgctgatcccttcaatggcatctgcagggaaccagaaccaccttctaatgaa
accccctcctccacagagacctcagccattcccgaggaggaaatagactggatagagaaa
cattgtgtgaaagtcaacaatgaccttctcatctccaaggtgttttattttttcttttac
tctgcctatggctctctttaccctctcttacctgtatattataaacagctgggaatgtca
cctagccagagtggactgttggtgggcattcgatacttcattgaattctgcagtgccccc
ttctggggtgtagttgcagatcgtttcagaaagggcaaaattgtcctcctcttttcgctt
ctgtgttgggttttgttcaacctgggcattggatttgtcaaacctgctaccttgagatgt
ctaccaaagatccccccaacagctcaccccaccaatgtaagtcacccagtaactgttctg
ccaatgaactcctccactgtcgctttctttagcacaccaccaaaattgctccagaaaagg
gacgtgcaattgtctgaaacagagcccaatatctcagacatagatctcgtgtcaacagca
ttgaccttgaccagtgaacccacacggaggccccagacagaggcaattacccaccctgtt
acaggcttgattttgaacacaagcacagtgactctgccccccacaggaaatgtcaccagg
gagacaaccattgctgtggtcaccaccaccaaatctttaccatctgatcaagtcaccctt
gtgtatgaccaacaggaagttgaggcgatattcttaattatcttagtggttgtcataata
ggagaatttttcagtgcctcttctgtcacgattgtagatacagtaaccctccagtacctg
ggaaaacaccgagaccgatatgggctacagcgcatgtggggctccctgggctggggcctg
gccatgctgtctgtgggtattggaatcgactatactcatatagatgtgctcattgatggg
aaggggtgtaagccccctgagtaccggaactaccagattgtcttcatcgtctttggagtt
ctcatgaccatggccctgatcgttgccactcagttccggttccgctacaaccacttcaac
aatagtgatggtaaagggaaagaggtggagatcccacaggtggaaagggacaactccaca
gagtcctctgaagagactccaactgccgcgactcactcacaggccttcaacttctgggac
ttgatcaagttgctatgcagtgtgcagtatggctcggttctgtttgtggcctggttcatg
ggttttggatacggcttcgtgttcacctttctctactggcatctggaagacctaaatgga
actacaaccctctttggggtctgttcagtcctgagtcatgtgtccgagttgaccgcttac
ttcttcagccacaagcttattgagttgattggccatatcagggttttatacattggcctg
gcctgtaatacagctcgctatatttacatttcctacctggaaaatgcctggactgtcctc
cctatggaagttcttcaaggtgtcacacacgcagccatctgggcagcgtgcatctcttac
ctcagtgcagctgtcccccctgagctgaggacttctgcacagggaatcctgcaaggcctt
catctgggtctggggcgaggatgtggtgccatgatcggaggcgtgttagtcaattatttt
ggggctgctgcaactttccgagggattggcatggcttgcctggtgatccttctcctcttt
gccctgatccagtggctggcagtaccagatgaagaagaagacaagacaatgttggcagaa
aggatcccagttccctctagtcccgttcccatagcaaccattgacctggtacagcaacag
acagaagatgtcatgccacgcgttgaggccagacttccgcccaagaaaaccaagcaccag
gaagagcaggaagatgtaaataaaccggcctggggggtcagctcctcgccttgggtgacc
tttgtctatgctctctaccaagttaaagagctaattcaactgacaagagagagccgtgct
tctgagatacaacctttacaggtaaccctctgctgggctagcgtggcgtctgcaccgtta
ctccctccttgttcatcaaaacacatgggaaacagaaaaacaggcatgttagcaaaggat
atcagtggtctgcgatcactctgtcacagtgtttaccaggtagcatag

DBGET integrated database retrieval system