KEGG   Mus musculus (house mouse): 98685
Entry
98685             CDS       T01002                                 
Symbol
Trmt1l, 1190005F20Rik, C1orf25, Trm1-like, Trm1l
Name
(RefSeq) tRNA methyltransferase 1 like
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: TRM Met_10 Methyltransf_31 Methyltransf_25 zf-C2H2_4 MTS
Other DBs
NCBI-GeneID: 98685
NCBI-ProteinID: NP_081152
MGI: 1916185
Ensembl: ENSMUSG00000053286
UniProt: A2RSY6 A0A0R4J0U8
Position
1:151304293..151333934
AA seq 728 aa
MENMAEEELLPQEKEEAQVRVPTRAPDSAPVPAPAADTALDSAPTPDSDPAPALAPAPAP
ALSPSLASVPEEAESKRHISIQRRLADLEKLAFGTEGDVDSASSLNSDNPGTENSQTCPL
CPKEKFRAYSSHKLRRHLQNLHWKISVEFEGYRMCICHLACRPVKPTIVGEQISSKLGAH
YHCIICSATITRRTDMLGHVKRHVNKGETKSRYIAASTAKSSNEILKETDTDIQVFPNYS
IPQKTDSYFNPKMKLNRQIIFCTLAALAKERKPLECLDAFGATGIMGLQWAKHLGNAVKV
TINDLNENSVTLIQKNCHLNKLKVVVDSEEKEEGDALEDDGTLGDIQVTRMDANVLMHLR
SFDFIHLDPFGTSVNYLDSAFRNVRNLGIVSVTSTDISSLYAKAQHVARRHYGCNIVRTE
YYKELAARIVVAAVARAAARCNKGIEVLFAVALEHFVLVVVRVLRGPTSADETAKKIQYL
IHCQWCEERIFQKDGNMVEENPYRQLPCNCHGSMPGKTAIELGPLWSSSLFNTGFLKRML
FESIHHGLDDIQPLIKTLIFESECTPQSQCSTHAPSNTNKQEENGVFVKTTDDTTIDIYS
AQGKRKSNEMAINLAKKQKTDASTAHPPFYYNIHRHSIKGMNMPKLKKFLCCLSQAGFRV
SRTHFDPMGIRTDAPLMQFKSILLKYSTPTYTGAQSEGQMPPAAEDTVTDRVEMSVSDKA
EASGCRRW
NT seq 2187 nt   +upstreamnt  +downstreamnt
atggagaatatggcggaggaggagctgctaccccaggagaaggaggaggcccaggtcagg
gtcccgacccgggccccggattcggctccggtcccagctccggccgcagatacggctctg
gactcggctccgacgccggactcggatccagccccagcccttgccccggccccggctccg
gccctgtccccgtccctagcctctgtccccgaggaggctgaaagcaagagacacatctca
attcaaaggcggcttgctgacctggagaagttagcttttgggactgaaggagatgttgac
tctgccagttcattgaactcagataatccaggcacagaaaacagtcaaacttgcccgctg
tgtcctaaggaaaagttcagagcttatagtagtcacaagcttcgtcgacaccttcagaat
ttacactggaaaatctcagttgaatttgaaggctacagaatgtgcatctgtcacttagcc
tgccgcccggtgaagccaaccatcgttggagaacagatatccagtaaactgggcgcccat
tatcactgcatcatttgttcagcaacaatcaccaggaggactgacatgctagggcatgtt
aagcgccatgtcaacaaaggggaaactaaatccaggtacattgctgcttctactgccaaa
tcatctaatgagattttgaaggagacagacacagacatacaagtttttcctaactactct
atacctcagaaaacagattcatattttaatcccaaaatgaagctaaatcgtcagataata
ttctgtacattggctgctttggctaaggaacgaaaacctttggagtgtttagatgccttt
ggagccactggaataatgggattacagtgggcaaagcaccttggaaatgcagtcaaagtt
acaattaatgacttgaatgaaaactctgtgactttgattcagaaaaactgccacttaaac
aagttaaaagtggtagtggacagcgaggaaaaggaagagggtgatgccctcgaagacgac
ggcactctgggggatatccaggtgaccaggatggacgccaatgttctgatgcacctcaga
tcttttgactttatacatctggatccctttggaacgtcagtgaactacctcgactctgcg
ttcagaaatgtaaggaaccttggcatagtgtcagtgacttctacagacatcagctccttg
tatgccaaggcacagcatgttgcccggcgtcactacggatgtaacattgtccgaacagag
tattacaaggagctggcggccagaattgtcgtagctgcagtggcaagagctgcagcacgg
tgcaacaaaggtatagaagtgctgtttgcggtggccctggaacacttcgtgttggtagtt
gtgagggtcttaagaggccctacttcagcggacgagactgccaagaaaatccagtacctg
atccactgccagtggtgtgaagagaggatttttcagaaggatggaaacatggtggaagaa
aacccatacagacagctgccctgtaattgtcatgggagcatgcctggcaagacagcgata
gaactcgggcctctgtggtcaagttcccttttcaatactggattcctcaaaaggatgcta
tttgaatctattcaccatggtttggatgacattcaacccctaataaagacattaatcttt
gaatcagagtgtaccccccaaagccagtgttcaactcatgcaccttcaaataccaacaag
caagaagaaaatggcgtatttgttaaaaccaccgatgataccacaatagatatttacagt
gcacagggcaagagaaaaagtaatgagatggccattaacctagccaaaaagcagaagacc
gacgccagcacggctcacccgcccttttactacaacatccacaggcacagcatcaaaggg
atgaacatgccgaagttaaaaaaatttttgtgctgtctttcgcaagcaggctttcgagta
agccgaactcactttgacccaatgggcatccgtaccgatgcccctctgatgcagtttaaa
tccatcttgctaaagtacagcacccccacttacactggagcacaatcagaaggccagatg
ccgccagcagctgaggacacggtcaccgacagggttgagatgtccgtgagtgacaaagcg
gaagcgagtggctgcaggagatggtga

DBGET integrated database retrieval system