KEGG   Mus musculus (mouse): 98828Help
Entry
98828             CDS       T01002                                 

Gene name
Cdc123, AA959893, G431001I09Rik
Definition
(RefSeq) cell division cycle 123
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: D123 DUF4343 Reg_prop
Motif
Other DBs
NCBI-GeneID: 98828
NCBI-ProteinID: NP_598598
MGI: 2138811
Ensembl: ENSMUSG00000039128
Vega: OTTMUSG00000010879
UniProt: Q8CII2
Position
2; 2 A1
AA seq 336 aa AA seqDB search
MKKEHVSHCQFSAWYPLFRSLTIKSVILPLPQNVKDYLLDDGTLVVSGREDPPTCSQSDS
GNEAEETQWSDDESTATLTAPEFPEFNTQVQEAINSLGGSVFPKLNWSAPRDAYWIAMNS
SLKCKTLSDIFLLFKSSDFITHDFTQPFIHCTDDSPDPCIEYELVLRKWCELIPGAEFRC
FVKENKLIGISQRDYTQYYDHISKQKEEICRCIQDFFKEHLQYKFLDEDFVFDIYRDSRG
KVWLIDFNPFGEVTDSLLFTWEELTSENNLRGEVTEGDAQEQDSPAFRCTNSEVTVQPSP
YLSFGLPKDFVDLSTGEDAHKLIDFLKLKRNEQEDD
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaggagcatgttagtcactgtcagttctccgcgtggtacccacttttccgaagc
cttaccatcaagagtgtcatcctcccgcttcctcagaatgtgaaagactatctacttgat
gatgggactctggtggtctcaggaagggaagatccgccaacatgctcccagtcagacagt
ggtaacgaagcagaggaaacacagtggtccgatgatgagagcacagccacacttacggca
ccagagtttcctgagttcaacactcaagtccaagaagctatcaattcgctggggggtagt
gtcttccctaagcttaactggagtgccccaagggatgcgtactggatagcgatgaacagt
tccctgaagtgtaaaactctcagtgatatcttcctgcttttcaagagttctgatttcatc
acccatgacttcacacagccgtttattcattgcactgatgactctccagacccttgtata
gagtacgagcttgttctccgaaaatggtgtgaattaattcctggggctgaattccgatgt
tttgtcaaagaaaataagcttattggtatttctcagagggattacacacaatactatgat
catatttctaagcaaaaagaagaaatttgcagatgcattcaagactttttcaaggaacac
ctacagtataaattcttagatgaagactttgtgttcgatatatacagggacagtaggggg
aaggtgtggctcattgactttaatccatttggggaggtcacagactcactgttgtttact
tgggaagagctaacatctgagaacaacctacgtggtgaggtcactgaaggagatgctcag
gagcaggattctccagccttccgttgcacaaacagtgaagtcacagtgcagcccagcccc
tatctgagcttcgggctgcccaaggactttgtagacctttccaccggggaggatgctcac
aagctcatcgatttccttaagctgaaaagaaatgagcaagaggacgactga

DBGET integrated database retrieval system