KEGG   Mus musculus (house mouse): 98845
Entry
98845             CDS       T01002                                 
Symbol
Eps8l2, Eps8r2
Name
(RefSeq) EPS8-like 2
  KO
K17277  epidermal growth factor receptor kinase substrate 8
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    98845 (Eps8l2)
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:mmu03037]
    98845 (Eps8l2)
   04147 Exosome [BR:mmu04147]
    98845 (Eps8l2)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    98845 (Eps8l2)
Cilium and associated proteins [BR:mmu03037]
 Other cilia and associated proteins
  Stereociliary proteins
   98845 (Eps8l2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   98845 (Eps8l2)
SSDB
Motif
Pfam: PTB SAM_3 SH3_1 SH3_9 PID SH3_2 SH3_3 SAM_PNT
Other DBs
NCBI-GeneID: 98845
NCBI-ProteinID: NP_573454
MGI: 2138828
Ensembl: ENSMUSG00000025504
UniProt: Q99K30
Position
7:140918824..140942933
AA seq 729 aa
MSQSASMSCCPGAANGSLGRSDGVPRMSAKDLFEQRKKYSNSNVIMHETSQYHVQHLATF
IMDKSEAIASVDDAIRKLVQLSSKEKVWAQEVLLQVNDKSLRLLDVESQEELENFPLPTV
QHSQTVLNQLRYPSVLLLVCQDSDQNKPDIHFFHCDEVEAELVQEDIESALADYRLGKKM
RPQTLKGHQEKIRQRQSILPPPQSPAPIPFQRQPGDSPQAKNRVGLPLPVPFSEPGYRRR
ESQDEEPRAVLAQRIEKETQILNCTLDDIEWFVARLQKAAEAFKQLNQRKKGKKKNKKGP
AEGVLTLRARPPSEGEFVDCFQKTKLAINLLAKLQKHIQNPSAAELVHFLFGPLDLIINT
CGSPDIARSVSSPLLSTDAVSFLRGHLVPKEMTLWESLGETWMRPRSEWPREPQVPLYVP
KFRSGWEPPLDVLQEAPWEVEGLASVPSDQLTPKNRLSVRHSPKHSLSSESQAPEDIAPP
GSSPHANRGYQPTPAMTKYVKILYDFTARNANELSVLKDEVLEVLEDGRQWWKLRNRSGQ
AGYVPCNILAEARQEDVGAPLEQSGQKYWGPASPTHKLPPIFAGNKEELIHHMDEVNDEL
MKKISHIKTQPQRNFRVERSQPVHLPLTFESGPDEVRAWLEAKAFSARIVENLGILTGPQ
LFSLNKEELKKVCGEEGSRVYSQLTVQKAFLEKQQSGSELEKLMSKIRRAEDSYTSQHTS
PESEGAPHL
NT seq 2190 nt   +upstreamnt  +downstreamnt
atgagccagtcagcatccatgagctgctgcccaggagctgccaacggcagtctgggccgg
tctgatggtgtgcccaggatgagcgcaaaggacctgtttgagcagaggaagaagtactcc
aactccaacgtcatcatgcatgagacttcacagtatcacgtgcagcacctggccacattc
atcatggacaagagtgaggctattgcctccgtggatgacgccatccggaagctggtacag
ctgagctccaaggagaaggtctgggcccaggaagtcctgctgcaggtgaacgacaagtca
ctgcgactgctggatgttgagtcccaggaagagctggagaactttccgctgcccactgtg
cagcacagccagacagtgctaaaccagctgcgctacccctctgtgctgctgctggtgtgc
caggactcagaccagaacaagcccgacatccacttctttcactgtgacgaggtggaggcg
gaacttgtgcaggaagacattgagagtgctctggctgactaccggctggggaagaagatg
agaccacagaccctaaagggacaccaggagaagatccgccagcggcagtctatcttaccc
cctccacagagcccagcccccattcccttccagcgacagccaggagattcccctcaggcc
aagaaccgtgtgggcctgcccttgccagtgccattcagtgaaccaggctatcgcaggagg
gaatcccaggacgaggagccacgggctgtgctggctcagagaatagagaaggagacgcaa
atccttaactgcaccctggatgatattgaatggttcgtggccaggctgcagaaggcagct
gaggctttcaagcagttgaaccagcggaaaaaggggaagaagaagaacaagaaggggcca
gcagagggtgtccttacacttcgggcacgccccccctcggagggagagtttgttgactgt
ttccagaaaaccaagctggccatcaacctgctggcgaagctgcagaagcacatccaaaac
cctagtgcagccgagctggtgcacttcctcttcgggcctctggatctgatcatcaacaca
tgtggcagccccgacatagcacgctctgtctccagccctttgctgtccactgacgccgtg
agcttcttacgtggccacttggtccccaaagagatgacactgtgggaatcactgggggag
acctggatgaggcctcgctctgaatggccccgggagccacaggtgccactctatgtgccc
aagttccgcagcggctgggaaccacccctggatgtcctacaggaggctccctgggaggta
gaaggactggcatctgtgcccagtgatcagctgacccccaagaatcgactatctgtacga
cattccccaaagcacagcctctcctccgagtcccaagccccagaggacattgcaccacca
ggcagctccccacatgctaacaggggctaccagccaacaccagccatgaccaagtacgtc
aagatcctctatgatttcacagcgcgaaacgccaatgagctatctgtgctcaaggacgag
gtcctagaggtgctggaggacggccggcagtggtggaagctacgaaatcgcagtggccag
gcgggctatgtgccctgcaacatcctggctgaagctcggcaggaggacgtgggtgccccc
ttggaacagtctggccagaaatactggggtccagccagccccacccacaaactgccccca
attttcgcagggaacaaagaagagctaatccaccacatggacgaggtcaatgacgagctc
atgaaaaagatcagccacatcaagacacagccgcagcgcaacttccgcgtggagcgcagc
cagccagtgcacctgccgcttaccttcgagtcaggtccggatgaggtccgcgcctggctg
gaagccaaggccttcagtgccaggatcgtggagaacctgggcatcttaactggaccccag
ctcttctccctcaacaaggaggaactgaaaaaagtgtgcggggaagagggcagtcgcgtg
tacagccagctcacggttcagaaggccttcctggagaaacaacaaagtgggtcagaactg
gagaagctcatgagcaagatcaggagggccgaggacagctataccagccaacacacttca
ccagagtcagagggggcgccgcacctgtaa

DBGET integrated database retrieval system