KEGG   Mus musculus (mouse): 98970Help
Entry
98970             CDS       T01002                                 

Gene name
Fibcd1, AI448887
Definition
(RefSeq) fibrinogen C domain containing 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Fibrinogen_C CENP-F_leu_zip ATG16 ZapB
Motif
Other DBs
NCBI-GeneID: 98970
NCBI-ProteinID: NP_849218
MGI: 2138953
Ensembl: ENSMUSG00000026841
Vega: OTTMUSG00000012076
UniProt: A2AV25
Position
2; 2 B
AA seq 459 aa AA seqDB search
MVHERWKTVGSASQLEDRPRDKPQRASCSYVLCTVLLSLAVLLAVAVTGVVLFLNHTHTP
GTAPPPIVSTGTAGANSALVTVERADSSHLSLLIDPRCPDLTDSFARLEGIQASILRALS
EHQAQPRLDGAPELLDALADQLPRLLTRASELQAECAGLRKGHSLLGQGLSTLQSEQGRL
IQLLSESQGHMAHLVNSVSDVLEALQRERGLGRPRVKADLQRAPSRGARPRGCANGSRPR
DCLDVLLSGQQDDGVYSIFPTHYPAGFQVYCDMRTDGGGWTVFQRREDGSVNFFRGWEAY
REGFGKLTGEHWLGLKRIHALTTQAAYELHVDLEDFDNGTAYAHYGSFGVGLFSVDPEED
GYPLTVADYSGTAGDSLLKHSGMRFTTKDRDSDHSENNCAAFYRGAWWYRNCHTSNLNGQ
YLRGAHASYADGVEWSSWTGWQYSLKFSEMKIRPVREDR
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggtccacgagcggtggaagaccgtgggcagcgcgtcccaacttgaggaccgaccgcgc
gacaaaccgcagcgagcaagctgcagttatgtcctgtgcacggtgctcctgtcccttgcg
gtgctgctggcggtggctgtcaccggtgtggttctcttcctgaaccacacccacacacca
ggcacggcgcccccacccatcgtcagcacggggactgccggagccaacagtgccctggtc
actgtggagagggctgacagctcccacctcagccttctcatcgaccctcgctgccccgac
ctcactgacagcttcgcccgcctggaaggcatccaggcctccatccttcgggcactgagt
gagcaccaggcacagccgaggctggacggtgcccccgagctgctggacgcactggctgac
cagctgccccggctgctaacccgggcctctgagctgcaggctgaatgtgctgggctgcgc
aagggacacagcctgctgggccagggcctcagcaccctgcagagtgaacagggtcgcctc
atccagcttctctctgagagtcaaggtcacatggctcacctggtgaactcagtcagtgat
gtcctggaggctctgcagagggagcggggcctaggccggccccgtgtcaaggctgacctt
cagagggccccttcccggggagcccggccccgaggctgtgctaatggctctcggccgcgg
gactgcctggatgttctcctgagtggacagcaggatgatggtgtctactctatcttcccc
actcactacccagctggcttccaggtctactgtgacatgcgcactgatggtggaggctgg
acggtatttcagcgccgggaagatggctctgtgaactttttccgaggttgggaggcgtac
cgggagggcttcggcaagctcacaggagagcactggctggggctcaagcggattcacgcc
ctgaccacacaagcagcatacgagcttcacgtggacctagaagactttgacaacggcacc
gcctatgcccactacgggagttttggtgtgggcttgttctctgtggaccccgaggaggat
gggtacccactcacggtggctgactactccggcaccgcaggtgactccctcctgaagcac
agtggcatgaggtttaccaccaaggaccgggacagcgaccactcggagaacaactgtgcc
gccttctaccgaggagcctggtggtaccgcaactgtcacacatccaacctcaatggccag
tacctgcgtggtgcacacgcctcctacgcagacggcgtcgagtggtcctcttggacggga
tggcagtattcactcaagttctcggagatgaagatccggccggtccgtgaggaccgctag

DBGET integrated database retrieval system