KEGG   Mus musculus (mouse): 99003
Entry
99003             CDS       T01002                                 

Symbol
Qser1, 4732486I23Rik, AI502974
Name
(RefSeq) glutamine and serine rich 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: DUF4211
Other DBs
NCBI-GeneID: 99003
NCBI-ProteinID: NP_001116799
MGI: 2138986
Ensembl: ENSMUSG00000074994
Vega: OTTMUSG00000014966
UniProt: A2BIE1 Q3UR75
Position
2; 2 E2
AA seq 1698 aa
MHSSAATELFVAGPLPTTGTLPPPTLSAYQHSSTFSNRNFATTSPLVLQDSSFNTTSNGI
LSPHDPLLQIKTSQGTVPTALAFERLGSSALSNSVPPQSSTYRSAQESAPHLLQPQFSLL
PSTLGGAQQTPQAYNSALFPSSAASIERALLRECSVIKHHQRPSVTQSIQAQLTGSQHPL
HSYLSSASIGNFQEPSRQSSLSCSSVRDSTQVSNGVLPQKTPQVSAELAQSYSSVIPSSG
YLPSATKVDSCSTKQPLTSTTIPKPQSVIPPVQTLNYSKPLHNQSSVISGQAQIYSTAQL
PSLLSVSQSQNYGLVQPHNVPSIVHSQVYRSSRVEKLPSLYKTLTFSGSSQPVTSENQTL
SYSSNQQEVLSLVTNENYPAQTRDLPSVSESQNYSSGQSQGLSPVSQTQVSYSSQSQVLS
VVSPSESYASGQSLTLTAPSLSYSSASRGQSLPVSTPTPSYTSMHPSPNAQTQGSSAQPQ
EFLPAVQSSFASSTRGQTLQSSIPSPDPKSYAERKLDSSVYTSSKQDEFPVQKLQALQSQ
ASLESSSQRLPDGEVNAQESVYKTSKADDRYSQSVTRNNSHLEDQVVGVALQGSEQEENM
VGSMTQLNQQSGQSNNAVATDLKKATNLMQTPQVRLNTKDLNQQHSLMHKMHEAKVQQQH
DQIMSASSQIQIPNPALGQSHQALPHTSVLLDSACDLQILQQAGILQASLGQAKASLQVQ
RVQSPQQIVHPFLQMDGHIIQSNGEHPQQQLHPHNSDIMKLDLPEPSKPLQQLTTKGPFS
EANPHDSKNQFVSLGSICFSEAMLLSDERNILSNVDDILAATAAACGVTPSDFSKSAANE
TMQDIESSDSKSHYQQSLNVRHVNSDFNSIAASVGKPQSINDISLNGNQVSVSLSSVPTL
QSETVLDQPHMETPSQTIPTKVPSAMVGLGQEIQEQSSDPFKKQLTINHESKEDREIAVD
SALSNNRNQEFVSNSRSISGDSVVSERDFTLVGDDTGVLVNPRRSTLALLAMPQPGDAAS
GKTEDEKQDVTYFNLPKEKAKGKEQGKEEEDNQKQLKRSAQCKRQNPRGTDVYVPYTSPS
LESCDEGFQHQEKMRQKIKEVEEKQPEVKTGFIASFLDFLKCGPKQQFSTLAVRVPNRTR
RSGIQTTRTFCPPPFAKTSPAAQAPSETGGVSLSEKVDSELKTLEQLSSFSSDEEDPGSC
GHDIYKNTSAPLTVLDATSDKTKKTVLEALPVATPGASAETAGVAPTASTAVATIKQDLH
LTSLTVNTMENANSTESPTAIELDSLPSDQLAKGQDTVAIEGFTDEENIESGGEGQYRER
DEFVVKIEDIETFKEALNTGKEPPAIWKVQKALLQKFVPEIRDGQREFAATNSYLGYFGD
AKTKYKRIYVKFIENANKKEYVRVCSKKPRNKPSQTIRNIPSKPSSISKTSDPPVSKTTT
TKTPSTKPKAKQLKIKAEPPPKKRKKWKEEFSSSQSESSPEVRSSSSEDEGFEPPAPSVT
RFLNTRAMKETFKSYMELLVSIALDPDTMQALEKSNDELLLPHMKKIDGMLNDNRKRLLV
NLHLDQPFKNALESFPELTVITRDSKAKSGGSAISKIKMNGKAYNKKTLRTSKTTTKSAQ
EFAVDPEKIQLYSLYHSLHHYKYHVYLICKNEISSVQKKNEDLGQEEIVQLCMKNVKWVE
DLFEKFGELLNHVQQKCS
NT seq 5097 nt   +upstreamnt  +downstreamnt
atgcattcctcagcagcaactgagctgtttgttgcaggacccttgccaaccactgggaca
cttccaccaccaactttgtctgcctatcagcattcatctacctttagcaatagaaacttt
gcgaccacctcacctttggtgcttcaagattcatcttttaacactacatccaatggaatt
ttaagccctcatgaccctttgctacaaattaagacttcccagggaactgttccgactgct
ttggcatttgagcgcctgggcagttctgcattaagtaacagcgtaccacctcagtcttca
acatatcgctcagctcaagagtcagcaccccatcttttacaacctcaatttagtttgttg
ccttcaacacttgggggagcccagcaaacccctcaagcctataattcagctctttttcct
agttctgctgcttccattgaaagagcccttcttcgagaatgtagcgttattaaacaccac
cagcggccttcagttacccagtctattcaggcacaactgactggttcacagcatccctta
catagctacctatcaagtgcaagtattggtaattttcaggaaccatccaggcagtcgtct
ttatcctgtagttcagttcgagattctactcaggtgagcaatggagtattgccgcagaag
acccctcaggtctcagcagaacttgctcagtcttactcatctgtaattccatcatcaggg
tatcttccttctgctacaaaagtagacagctgttctacaaaacaaccactaacatcaact
acaattccgaagcctcaaagtgtaattcctcctgtgcaaacactaaactattctaaacct
ttacataaccagagttctgtaatatcaggtcaagcacaaatttattctacagcacagcta
ccaagccttttatcagtcagtcagtcccaaaattatggtttagtacagccacataatgtg
ccatctattgttcattcacaggtttataggtccagcagggttgagaaattgccatcctta
tataaaacattgactttttctgggtcatctcagcctgtaacctctgaaaaccagacactt
agttattcatccaatcagcaagaagtattatccttagttacaaatgagaattatcctgct
caaacaagagacctgccatcagtcagtgagtctcaaaattattcttctggtcagtctcag
ggtttatcaccagttagccaaacacaggtcagttattcatctcagtctcaagttttatca
gttgttagtccttcagaaagctatgcatcaggacagtctctgacattaacagccccttct
ctttcttattcttctgcctctcggggtcagagcttgccagtttctaccccaacaccaagt
tatacttctatgcatccatccccaaatgctcagacccaaggatcttctgctcagccccaa
gagtttctgcctgctgtgcagtcctcttttgcatcctctactcgtggtcagacattacaa
agtagcataccttctcctgatccaaagtcttatgctgaaaggaagcttgactcaagtgtg
tatacatcgtcaaagcaagatgagtttccagtgcaaaaattacaggcattgcagtcacaa
gcatctcttgaatcatcaagccaaaggctacccgatggggaagtgaatgctcaagagtca
gtttataagacatcaaaggcagatgataggtattctcagagtgtaaccagaaataactct
caccttgaagatcaagttgttggagttgctctccagggttcagaacaggaagaaaacatg
gtcggttcaatgacacaacttaaccagcaaagtggccagtccaataatgcagtagccact
gatcttaagaaggcaactaatttaatgcaaactccacaggtaaggttgaatactaaagac
ctcaaccagcagcattctctcatgcacaagatgcatgaagcgaaggttcagcaacagcat
gatcaaataatgagtgcctcatctcagatacagattccaaatcctgctttagggcagagt
catcaggctcttcctcatacatcagtccttttagactctgcctgtgacttacagattctt
caacaggctggaattctccaggctagcctgggacaagcaaaggcatccttgcaagtacag
cgtgttcagagtccgcaacagatagtccatcctttcctacagatggatggtcatatcatc
cagagcaacggtgaacatcctcaacagcagctccatcctcacaattctgatattatgaaa
ctagacctccctgaaccttcaaaaccattgcaacagctaacaacaaagggccccttcagt
gaagccaatccacatgactcaaagaatcagtttgtttctcttggatcaatatgcttctca
gaggcaatgcttctcagtgatgaaagaaatattttatcaaatgtagatgacatcttagca
gctacagcagcagcttgtggggttacaccttctgacttttccaagtcagctgcaaatgaa
accatgcaagatattgaaagtagtgattctaagtctcattatcagcagtcattaaatgtc
aggcatgtgaattcagattttaactccatagcagcttcagtaggaaagccacagagtatt
aatgatatttccttaaatggaaatcaggttagtgtgagtctttcatcagtgcccaccctt
cagtcagaaacagttcttgatcaaccgcatatggaaacacctagtcaaactataccaact
aaagtaccttctgccatggttggactgggtcaggaaatccaggaacaaagttctgaccca
ttcaagaaacagttgactataaaccatgagtctaaagaagacagggaaattgctgttgac
agtgcactgagtaataacagaaatcaagagtttgtctctaatagtcggagcataagtgga
gacagtgtagtatcagagcgtgactttaccctagtaggtgatgacactggtgtgttggtg
aaccctagaaggagtacacttgcactgctggccatgccccagccaggggatgcagccagt
ggcaagactgaagatgaaaaacaagatgtaacatattttaaccttccaaaggaaaaagct
aaaggaaaagaacaaggtaaagaggaagaagataatcaaaaacagctgaaaaggtctgct
caatgcaagcgacagaaccccagagggacagatgtgtatgtaccatacacttccccttcc
ttggaaagctgcgatgaaggttttcagcatcaagaaaagatgaggcagaaaatcaaggaa
gtggaggaaaagcagccagaggtcaaaacaggatttattgcttcttttttagacttcctg
aagtgtgggcccaagcagcagttctccactcttgctgttcgagtacctaacagaaccaga
cgatcaggaatccaaaccacccgtacgttctgtcccccaccttttgcaaagacatcacct
gcagcacaagcaccatctgaaacaggaggggtcagtctgtcagaaaaagttgacagtgaa
cttaaaactttagaacaattatcttcattttcttctgatgaggaagatcctggctcgtgt
ggccatgatatctataagaacacctctgctcctttaactgtgttggatgctacttccgat
aaaacaaagaaaacagttttagaagctctgcctgtggcaactcctggtgcatctgctgag
actgctggtgttgctcccactgcctccactgctgttgcaacaattaaacaagaccttcat
ctgacttcattaactgtcaacaccatggaaaatgccaactccacagaatcccccacagcc
atcgaacttgatagtcttccttcagaccagttggcaaaaggacaggacacagttgcaata
gaaggttttacagatgaggaaaatattgaaagtggaggtgaaggtcaatacagggaacgt
gatgaatttgtggtaaagatagaagacatagagacctttaaggaggctttaaatacggga
aaagagcccccagctatttggaaagtacagaaagctttgttacagaaatttgttcctgaa
attcgagatgggcaaagagaatttgcagctacaaatagttaccttgggtattttggagat
gcaaaaactaaatacaaaaggatatatgtgaagttcattgaaaatgcaaacaaaaaggaa
tatgtcagagtgtgttccaaaaagccaagaaataagccttcacaaactatcagaaatatt
ccatctaagccaagtagtatcagtaaaacttctgacccaccagtatcaaaaactacaact
acaaaaaccccgtctacaaaacccaaagctaaacagctcaaaataaaggctgagccacca
ccaaagaaaaggaagaaatggaaggaagaattttcatcatcacaatctgaatcatctcct
gaggtccgttctagcagtagtgaggatgagggctttgagcctccagccccctctgtcact
cgttttctgaacacaagagcaatgaaggaaactttcaagagttacatggaattgcttgtt
agcattgctctggatcctgacaccatgcaagccctagaaaagagcaacgatgagctactt
ttaccacatatgaaaaaaatagatggaatgctgaatgataaccggaaaagacttcttgtg
aatcttcatttggaccagccattcaagaatgctttggaaagttttcctgaactgacagtt
attactcgagactctaaagcaaagagtggaggatctgctatttctaagatcaaaatgaat
ggcaaagcttataataagaaaactctaaggacttctaaaacaaccactaagtctgcacag
gagtttgctgttgatccagagaaaatacagttatattccttatatcattcactccatcat
tataaataccatgtttatctcatatgtaagaatgagatatcatctgtgcagaaaaaaaat
gaagatttaggacaggaagaaattgttcaactttgtatgaaaaatgtaaagtgggtggag
gacctatttgaaaaatttggagaacttctaaatcatgtacaacagaaatgttcctaa

DBGET integrated database retrieval system