KEGG   Mus musculus (mouse): 99010Help
Entry
99010             CDS       T01002                                 

Gene name
Lpcat4, AI505034, Agpat7, Aytl3, LPEAT2
Definition
(RefSeq) lysophosphatidylcholine acyltransferase 4
  KO
K13512  lysophospholipid acyltransferase [EC:2.3.1.23 2.3.1.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00564  Glycerophospholipid metabolism
mmu00565  Ether lipid metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    99010 (Lpcat4)
   00565 Ether lipid metabolism
    99010 (Lpcat4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmu01004]
    99010 (Lpcat4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.23  1-acylglycerophosphocholine O-acyltransferase
     99010 (Lpcat4)
    2.3.1.-  
     99010 (Lpcat4)
Lipid biosynthesis proteins [BR:mmu01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   99010 (Lpcat4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyltransferase Adhes-Ig_like
Motif
Other DBs
NCBI-GeneID: 99010
NCBI-ProteinID: NP_997089
MGI: 2138993
Ensembl: ENSMUSG00000027134
Vega: OTTMUSG00000015146
UniProt: Q6NVG1
Position
2; 2 E3
AA seq 524 aa AA seqDB search
MSQGSPGAWAPLDPTSGSSASPNPFVHELHLSGLQRVKFCLLGVLLAPIRVLLAFIVLFL
LWPFAWLQVAGLTEEQLQEPITGWRKTVCHNGVLGLSRLLFFLLGFLRIRVRGQRASRLE
APVLVAAPHSTFFDPIVLLPCDLPKVVSRAENLSVPVIGALLRFNQAILVSRHDPASRRR
VVEEVRRRATSGGKWPQVLFFPEGTCSNKKALLKFKPGAFIAGVPVQPVLIRYPNSLDTT
SWAWRGPGVLKVLWLTASQPCSIVDVEFLPVYQPSLEESKDPTLYANNVQRVMAQALGIP
ATECEFVGSLPVIVVGQLKVALEPQLWELAKVLQKAGLSPGFVDMGAEPGRSRMISQEAF
AQQLQLSDPQTVAGAFSYFQQDAKGLVDFRNVALALAALDGGRSLEELTRLAFELFAEEQ
AEGSDRLLYKDGFSTILHLLLGSPRPAATTLHAELCQPGCSQGLSLCQFQNFSLHDPLYG
KLFSAYLRPPHKPRSTSQIPNASSPSSPTALANGTVQAPKQKGD
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgagccagggaagtcctggggcctgggcccccctggatcccacctctgggtcctctgcg
tccccaaacccgttcgtgcatgagttacacctctccggcctccagagggttaagttctgc
ctcctgggggtactgctggccccaatccgagtacttctagcttttattgtcctctttctc
ctctggcccttcgcgtggctccaagtagcaggtctcactgaagagcagcttcaggaacca
attacaggatggaggaagactgtatgccacaacggggttcttggtctgagccgcctgcta
tttttcctgcttggcttccttcggatccgtgttcggggtcaaagggcctctcgcctcgaa
gcccctgtcctggttgctgccccccactcaactttctttgacccaattgtcctgctaccc
tgtgacctgcccaaggttgtgtctcgagctgagaatctttctgtgcctgtcattggagca
ctccttcgatttaatcaagccatcctagtctcccggcatgaccccgcctctcggcgcaga
gtggttgaggaggtcagaaggcgggctacttcaggaggcaagtggcctcaggtactattt
tttcctgaaggcacctgttccaacaagaaggctctgctgaagttcaaaccaggagccttc
atcgcaggggtgcccgtgcagcccgtcctcatccgataccccaacagtctggacaccacc
agctgggcatggaggggccccggcgtactcaaagttctctggctcaccgcctctcagccc
tgcagcatcgtggatgtagagttcctccctgtctatcagcccagcctggaggagagtaag
gaccccaccctttatgccaacaacgtccagagagtcatggcacaggccctgggcattcca
gccactgaatgtgagtttgtagggagcttgcctgtgattgtggtgggccagctgaaggta
gcgttggagccgcagctctgggagctggcaaaggtgctacagaaggctgggctgtcccct
ggctttgtggacatgggggcagagccaggccggagtcgaatgatcagccaagaggccttt
gcccaacagttacagctctcggatcctcagacagtggctggtgccttcagctacttccag
caggatgccaagggtttggttgacttccgaaatgtggccctagcgctagcggccctggac
gggggcaggagcctggaggagctgactcgcctggcctttgagctctttgctgaagagcag
gcagaaggatctgaccggctgctgtacaaagacggcttcagcaccatcctgcacctgttg
ctgggttcaccccgccccgctgccacgactttgcatgccgagctgtgccagcctggatgc
agccagggcctctccctctgtcagttccagaacttctccctccacgaccctctgtacggc
aagcttttcagcgcctacctacgccccccacacaagcctcgaagcacctcccagatacca
aatgcctcatcccccagcagccccactgccctggccaacgggactgtgcaggcccccaag
cagaagggagactga

DBGET integrated database retrieval system