KEGG   Mus musculus (mouse): 99031
Entry
99031             CDS       T01002                                 

Symbol
Osbpl6, 1110062M20Rik, AI596402, OR, ORP-6, mKIAA4128
Name
(RefSeq) oxysterol binding protein-like 6
  KO
K20463  oxysterol-binding protein-related protein 3/6/7
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    99031 (Osbpl6)
Membrane trafficking [BR:mmu04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Oxysterol-binding proteins
    99031 (Osbpl6)
SSDB
Motif
Pfam: Oxysterol_BP PH_8 PH
Other DBs
NCBI-GeneID: 99031
NCBI-ProteinID: NP_001277662
MGI: 2139014
Ensembl: ENSMUSG00000042359
Vega: OTTMUSG00000013133
UniProt: Q8BXR9
Position
2; 2 C3
AA seq 959 aa
MSSDEKGISPAHKTSTPTHRSASSSTSSQRESRQSIHVLERTASSSTEPSVSRQLLEPEP
IPLSKEADSWEIIEGLKIGQTNVQKPDRHEGFMLKKRKWPLKGWHKRFFVLDNGMLKYSK
APLDIQKGKVHGSIDVGLSVMSIKKKARRIDLDTEEHIYHLKVKSQDWFDAWVSKLRHHR
LYRQNEIVRSPRDASFHIFPATSTAESSPAANVSVVDGKMQPNSFPWQSPLPCSNSLPAT
CTTGQSKVAAWLQDSEEMDRCAEDLAHCQSNLVELSKLLQNLEILQRTQSAPNFTDMQAN
CVDISKKDKRVTRRWRTKSVSKDTKIQLQEGPPAKGQFNTTRRRQRLAAAVATTVPFSAT
MSPVRLHSSNPNLCADIEFQTPPSHLTDPLESSTDYTKLQEEFCLIAQKVHSLLKSAFNS
IAIEKEKLKQVVSEQDHNKGHSTQMARLRQSLSQALNQNAELRSRLNRIHSESTICDHVV
SVNIIPSPDEPGEQIHVSLPLSQQVANESRLSMSESVSEFFDAQEVLLSASSSENEASDD
ESYISDVSDNISEDNTSVADNISRQILNGELTGGAFRNGRRTCLPAPCPDTSNINLWNIL
RNNIGKDLSKVSMPVELNEPLNTLQHLCEEMEYSELLDKASETDDPYERMVLVAAFAVSG
YCSTYFRAGSKPFNPVLGETYECIREDKGFRFFSEQVSHHPPISACHCESKNFVFWQDIR
WKNKFWGKSMEILPVGTLNVTLPKYGDYYVWNKVTTCIHNILSGRRWIEHYGEVTLRNTK
SSVCICKLTFVKVNYWNSNVNEVQGVVIDQEGKVVHRLFGKWHEGLYCGVAPSAKCIWRP
GSLPTNYELYYGFTRFAVELNELDPVLKDLLPPTDARFRPDQRFLEEGNLEAAAAEKQRV
EELQRSRRRYMEENNLEHIPKFFKKVIDANQREAWVSNDTYWELRKDPGFSKVDSPVLW
NT seq 2880 nt   +upstreamnt  +downstreamnt
atgagttcagacgagaagggcatatcccctgctcataaaacatccactccgacccataga
agtgcctcgtcttcaacatcttctcagagggaaagcagacagagcatccacgttttggag
agaactgcttcatccagcacggagccctctgtcagtcggcagttgctagagccggagccc
atccccctctccaaggaagctgacagctgggaaattatagaagggctgaaaataggccaa
accaatgtccagaaaccagacaggcacgagggatttatgctgaagaaaagaaaatggcct
ttaaagggctggcacaagcgcttttttgtcctggataatggaatgctgaagtattccaag
gcgccacttgatatccaaaaaggaaaagtgcacgggagcatagatgtcggactgtctgtc
atgtcgattaaaaagaaagctcggaggatagaccttgacacggaagagcacatctatcat
ttgaaggtgaaatcccaggactggtttgacgcttgggtctccaaactgcgccatcacagg
ttgtaccgtcagaatgaaattgtgaggtcgccgagagatgccagtttccacatatttcct
gcaacttcgacagctgagtcctccccggctgctaatgtctctgttgtggatggaaagatg
cagcccaacagctttccatggcagtcgccattaccatgcagtaacagcctccctgcgacc
tgcacaactgggcagagtaaagtggcagcctggctgcaggactcagaagaaatggacagg
tgtgcagaagatcttgcacactgccagtcaaaccttgtggaacttagcaagctcctgcaa
aacttggagatccttcagagaactcagtcggcgcctaacttcactgacatgcaggctaac
tgtgtagatatttcaaagaaagacaagcgggtcacaagacgctggaggacaaaaagtgtc
agcaaagatacaaaaatacagctccaggaagggccacctgcgaagggccagttcaacaca
actcggcgccggcagaggctagcggcagcagtggctacaacagttcctttcagcgccacc
atgtcacccgtgcgtctgcactcctccaaccccaacctttgtgcagacattgagttccag
acccctcctagccacctcaccgaccctctggaaagttccacggattataccaagctacaa
gaagaattttgtctaattgcacagaaagtgcattctcttctgaagtctgcatttaacagc
atagctatagagaaggagaagctgaagcaggtggtctcggagcaagatcacaacaaaggc
cacagcacacagatggccagactccggcagtcactgtcacaggcacttaaccagaacgct
gagctccggagtcggctgaacagaatacactcagagtctaccatttgtgatcacgttgtc
agtgtaaatattatccctagccccgatgagcctggtgagcaaatccatgtcagcctccct
ctgtcacagcaggtggccaacgagagccgcctctccatgtcagaatccgtgtcagaattc
ttcgatgcccaagaggtgctcctgtctgcaagctcatcagagaatgaggcttctgatgat
gagtcctacatcagcgacgtgagtgacaacatatctgaggacaacaccagtgtcgccgac
aacatttctcggcaaatcctgaatggggagctcacaggaggcgccttccgcaatggccgt
cgcacctgcctgcctgctccttgcccggacaccagtaacattaacctgtggaatatcttg
aggaacaacattggcaaagacctgtcgaaggtctccatgcccgtggaactcaacgagccc
ctcaacaccctgcagcacctctgtgaggaaatggaatacagtgagctcctggacaaggcc
tcagagaccgacgacccctacgagaggatggttctcgtcgctgcctttgcagtctcaggg
tactgttccacctacttccgagcaggaagcaagccattcaatccggtcctgggggagacc
tatgaatgcataagagaagataaggggtttcggttcttctcagaacaagttagccatcat
ccacccatttctgcctgtcactgtgaatccaagaattttgtgttttggcaagatatcaga
tggaaaaataagttctggggaaagtccatggaaatcctgcctgtcggaaccctgaacgtc
acgcttccaaaatatggggattactatgtgtggaataaagtcaccacgtgcatacacaat
atcctgagtgggaggagatggatcgagcactacggtgaagtgacccttagaaataccaaa
agcagtgtttgcatttgcaaactcacgtttgtcaaggtgaattactggaactccaacgtg
aatgaagtccagggggtggtgatagaccaggaggggaaggtggtgcaccggctgtttggg
aaatggcacgaaggactctactgcggggtggccccctcggcaaagtgcatctggagacca
ggttctctgccaaccaactatgagctctactatggctttacaagatttgctgtggagctc
aatgagttggaccccgtcctgaaggacctccttccccccacagatgcccgattccggcca
gatcaaaggtttttggaagaagggaacctagaagccgcagccgcagagaaacaaagagtt
gaggaactccaaagatcgcgaagacgctacatggaggaaaacaaccttgaacatatacca
aaattttttaaaaaagttattgatgcaaatcaaagagaagcctgggtttctaacgacacc
tactgggagcttcgaaaggaccctgggtttagcaaagtagacagccccgttctttggtaa

DBGET integrated database retrieval system