KEGG   Mus musculus (house mouse): 99045
Entry
99045             CDS       T01002                                 
Symbol
Mrps26, GI008, MRP-S13, MRP-S26, Rpms13
Name
(RefSeq) mitochondrial ribosomal protein S26
  KO
K17405  small subunit ribosomal protein S26
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mmu03011]
    99045 (Mrps26)
Ribosome [BR:mmu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    99045 (Mrps26)
SSDB
Motif
Pfam: MRP-S26 STAT_linker MAJIN
Other DBs
NCBI-GeneID: 99045
NCBI-ProteinID: NP_997090
MGI: 1333830
Ensembl: ENSMUSG00000037740
Position
2:130405677..130407314
AA seq 200 aa
MLRALNRLAARPETRPPTPLLLPVRGRKTRHDPPAKSKVGRVQTPPAVDPAEFFVLTERY
RQYRETVRALRLEFTLEVRRKLHEARAGVLAERKAQQAITEHRELMAWNRDENRRMQELR
IARLQLEAQAQEVQKAEAQAQRAQEEQAWVQLKEQEVLKLQEEAKNFITRENLEARIEEA
LDSPKSYNWAVTKEGQVVRN
NT seq 603 nt   +upstreamnt  +downstreamnt
atgttgcgcgctctgaaccgcctggcggcgcggccggagactcggcccccgaccccgctg
ctcctgcccgtgcgcggccgcaagacccgccatgacccgcctgccaaatccaaggtcgga
cgggtgcagacgcctcccgccgtggaccctgcggaattcttcgtgttgaccgagcgctac
cgacagtaccgggagaccgtgcgcgctctcaggctagagttcacgttggaggtgcgaagg
aaattgcacgaggcccgagccggggttctggccgagcgcaaggcgcagcaggccatcacg
gagcaccgggagctgatggcctggaaccgggacgagaaccggcgaatgcaggagctacgg
atagcgaggttgcagctggaagcacaggcccaggaggtgcagaaggctgaggcccaggcc
cagagggctcaggaggagcaggcttgggtgcaactgaaagagcaagaagtgctcaagctg
caggaggaggcaaaaaacttcatcactcgggagaacctggaggcacggatagaagaagcg
ttggactctccgaagagttacaactgggccgtcaccaaagaagggcaggtggtcaggaac
tga

DBGET integrated database retrieval system