KEGG   Mus musculus (mouse): 99138Help
Entry
99138             CDS       T01002                                 

Gene name
Stard7, AI852671, AL022671, AW544915
Definition
(RefSeq) START domain containing 7
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: START
Motif
Other DBs
NCBI-GeneID: 99138
NCBI-ProteinID: NP_647469
MGI: 2139090
Ensembl: ENSMUSG00000027367
Vega: OTTMUSG00000016010
UniProt: Q8R1R3
Position
2 F1; 2 61.88 cM
AA seq 373 aa AA seqDB search
MFPRRPPATLAAWLAGARGGGLLSALANQCRFVTGLRVRRAQQIAQLYGRLYSESSRCAL
LGRFWRRLRGRPGHASVLMAALSGVFVWDEERIQEEELQRSINEMKRLEEMSNIFQSSGV
ENYPPEPKSPAGGNEKSKDKEEPWEMVMDKKHFKLWRRPITGTHLYQYRVFGTYTDVTPR
QFFNVQLDTEYRKKWDALVIKLEVIERDAVSGSEVLHWVTHFPYPMYSRDYVYVRRYSVD
QENNVMVLVSRAVEHPSVPESPEFVRVRSYESQMVIRPHKSFDENGFDYLLTYSDNPQTV
FPRYCVSWMVSSGMPDFLEKLHMATLKAKNMEIKVKDYISAKPLEMSSEAKATAPSPERK
NEGSCGPARIEYA
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgttcccgaggaggccaccggccaccctggccgcctggctggcgggcgcgcggggcggg
ggcctgctgtccgcgctggccaatcagtgccgcttcgtgacgggcctgcgcgtgcggcga
gcgcagcagatcgcgcagctctacggccgcctgtattccgagagctcgcgctgcgccctg
ctcggacgcttctggcgccggctgcgaggccgccccggccatgcctctgttttgatggcg
gcgctctccggtgttttcgtatgggacgaggagagaatccaggaggaggagttgcagagg
tccattaatgagatgaaacggttggaagaaatgtcaaatatatttcagagctctggagtt
gagaattaccctcccgaaccaaagtccccagcaggagggaatgaaaagtcaaaagacaag
gaagaaccctgggaaatggtgatggacaagaaacacttcaagctgtggcgccgcccaatt
acaggcacccacctttaccagtaccgagtttttggaacatacacagatgtgactccccga
cagttcttcaatgttcagctggatacagagtacaggaaaaaatgggatgcccttgtgatc
aagctagaggtgattgagagagatgctgttagtggttctgaggttcttcattgggtaacc
cattttccttatccaatgtactctcgtgattatgtttatgttcggcggtatagtgtggat
caggaaaacaatgtgatggtcttggtgtcacgtgcggtggaacaccccagtgtgccagag
tctccagagtttgtcagggtcagatcttacgaatcccaaatggttatccgtcctcacaag
tcgtttgatgagaatggctttgactacttactgacatacagtgacaatccacagacagtg
ttccctcgatactgtgtcagttggatggtttctagtggcatgccagatttcttggagaag
ctgcacatggccactctgaaagccaagaacatggagatcaaagtgaaagactacatctcg
gctaagcctctggaaatgagcagtgaggccaaggccactgctccatcccctgagcggaag
aatgagggtagctgtggccctgctcggattgagtatgcttaa

DBGET integrated database retrieval system