KEGG   Mus musculus (mouse): 99152
Entry
99152             CDS       T01002                                 

Symbol
Anapc2, 9230107K09Rik, AL024279, Apc2, Emi4, Imi4, mKIAA1406
Name
(RefSeq) anaphase promoting complex subunit 2
  KO
K03349  anaphase-promoting complex subunit 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04120  Ubiquitin mediated proteolysis
mmu04914  Progesterone-mediated oocyte maturation
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    99152 (Anapc2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    99152 (Anapc2)
   04114 Oocyte meiosis
    99152 (Anapc2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    99152 (Anapc2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    99152 (Anapc2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    99152 (Anapc2)
   03036 Chromosome and associated proteins [BR:mmu03036]
    99152 (Anapc2)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Cullin
     99152 (Anapc2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    99152 (Anapc2)
SSDB
Motif
Pfam: Cullin ANAPC2
Other DBs
NCBI-GeneID: 99152
NCBI-ProteinID: NP_780509
MGI: 2139135
Ensembl: ENSMUSG00000026965
Vega: OTTMUSG00000011902
UniProt: Q8BZQ7
Position
2:25162469..25175928
AA seq 837 aa
MEAEGVAVAAAAAAAAAAATIIASDDCDSRPGQELLVAWNTVSTGLVPPAALGLASSRTS
GAVPPKEEELRAAVEVLRGHGLHSVLEEWFVEVLQNDLQGNIATEFWNAIALRENSVDEP
QCLGLLLDAFGLLESRLDPYLHSLELLEKWTRLGLLMGAGAQGLREKVHTMLRGVLFFST
PRTFQEMVQRLYGRFLRVYMQSKRKGEGGTDPELEGELDSRYARRRYYRLLQSPLCAGCG
SDKQQCWCRQALEQFNQLSQVLHRLSLLERVCAEAVTTTLHQVTRERMEDRCRGEYERSF
LREFHKWIERVVGWLGKVFLQDNPTRPTSPEAGNTLRRWRCHVQRFFYRIYATLRIEELF
SIIRDFPDSRPAIEDLKYCLERTDQRQQLLVSLKVALETRLLHPGVNTCDIITLYISAIK
ALRVLDPSMVILEVACEPIRRYLRTREDTVRQIVAGLTGDSDGTGDLAVELSKTDPACLE
TGQDSEDDSGEPEDWVPDPVDADPVKSSSKRRSSDIISLLVSIYGSKDLFINEYRSLLAD
RLLHQFSFSPEREIRNVELLKLRFGEAPMHFCEVMLKDMADSRRINANIREEDEKRPVEE
QPPFGVYAVILSSEFWPPFKDEKLEVPEDIRAALDVYCKKYEKLKAMRTLSWKHTLGLVT
MDVELADRTLSVAVTPVQAVVLLYFQNQASWTLEELSKVVKMPVALLRRRMSVWLQQGVL
REEPPGTFSVIEEERPQDRDNMVLIDSDDESDSGMASQADQKEEELLLFWAYIQAMLTNL
ESLSLERIYSMLRMFVMTGPALAEIDLQELQGYLQKKVRDQQLIYSAGVYRLPKNSN
NT seq 2514 nt   +upstreamnt  +downstreamnt
atggaggccgagggtgtggcggtggcggcggcggcggcggcggcggcggcggcggcgaca
attattgcctccgatgactgcgactctaggcctggacaggagctcttggttgcctggaat
actgtgagcaccggtctggtgccgccggccgcgctggggctggcgtcttcccggaccagc
ggtgcagtcccaccaaaggaggaagagcttcgtgcagcggtggaggttctgaggggacac
ggtctgcactctgtcctggaggagtggttcgtggaagtgctgcagaacgaccttcaaggc
aatattgccacggagttctggaatgccatcgctctgcgagaaaactctgtcgatgagccc
cagtgccttgggctgctcctggatgcgttcggtctgctggaaagccgcttggatccctat
ctgcatagcctagaactcctagagaaatggactcgtctgggcttgctgatgggcgctgga
gctcaggggcttcgggagaaagttcacactatgttgcggggagtcctgtttttttccacc
cctaggacattccaggagatggtccagcgcctctatggtcgtttcttgagagtctatatg
cagagcaagagaaaaggagaagggggcacagacccggaactagagggtgagctagatagc
cggtatgcccgccgcaggtactaccgacttttgcagagtcctctgtgcgcaggatgtggc
agtgacaagcagcagtgctggtgccggcaggcactggagcagttcaaccagctgagccag
gtcctgcataggctcagtctgctggagcgggtttgtgctgaggccgtgacaaccaccctg
catcaggtgacccgggaaaggatggaagaccgctgccgaggagagtatgagcgctctttt
ttgcgtgagtttcacaagtggatagagagagtggttggttggcttggcaaagtgttcctt
caggacaaccccaccagaccaacttctccagaagctgggaacacactgcgtcgttggcgc
tgccacgtacagagattcttctaccgtatctatgccaccctacgcatcgaggagcttttc
agcatcatccgagactttccagactcccggccagccattgaagaccttaagtactgcttg
gagaggacagatcagaggcagcaacttcttgtgtccctcaaggtggccctagagactcga
ctcctccacccaggtgtcaacacatgtgacatcatcactctctacatttctgccatcaag
gcattacgtgtgctagatccctctatggtcatcctggaagtggcttgtgagcccatccgt
cgatacctgaggacacgagaggacaccgtacggcagattgtggctgggctaaccggggac
tcagatgggactggggacttggctgttgagctgtctaagactgaccctgcctgcctggag
accggtcaggacagtgaggatgattctggagagcccgaggactgggtccctgaccctgtg
gatgctgatccagtgaagtcgagttccaagcgacgttcttcagacatcatcagcctgctg
gtcagcatctatggcagcaaagacctctttatcaatgagtaccgctcgctacttgcagat
cgccttctccaccaattcagcttcagccctgagagggagattcgtaatgtggagctgttg
aagctgcgctttggtgaagcccccatgcacttctgtgaggtcatgctcaaggacatggca
gactcccgccgcatcaatgccaatatccgagaggaggatgagaagcggcctgtggaagaa
cagccaccatttggggtctatgctgtcatattgtccagtgaattttggcctcccttcaaa
gatgagaagctggaggtccctgaggacatcagggcagccctagacgtttactgcaagaag
tatgagaaactgaaggctatgcggacacttagttggaagcacaccctgggcctggtgaca
atggatgtggagcttgctgaccgcaccctgtctgttgcggtgaccccagtacaggcagtg
gtcttgctgtatttccagaaccaagccagctggaccctggaggaactgagcaaggtggtg
aagatgcctgtggcactgcttcgaagacgcatgtcagtgtggctgcaacagggtgtgctg
cgggaggaacctccaggcactttctctgtcattgaggaagagcggcctcaggatagggac
aacatggtgctgattgacagtgatgatgagagtgactcaggcatggcctcccaggctgac
cagaaggaagaggagctactgctcttctgggcatacatccaggccatgttaaccaaccta
gagagcctctctctggagcgtatctacagcatgctccggatgtttgtaatgactggccct
gcgctggctgagattgacctgcaggagctgcagggctacttgcagaagaaggtccgagac
cagcagctcatctattctgcaggtgtctaccgcctgcctaagaattccaactga

DBGET integrated database retrieval system