KEGG   Mus musculus (mouse): 99169Help
Entry
99169             CDS       T01002                                 

Definition
(RefSeq) expressed sequence AU015228
  KO
K03136  transcription initiation factor TFIIE subunit alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03022  Basal transcription factors
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    99169
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    99169
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    99169
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIE
     99169
 Prokaryotic type
  Archaeal type
    TFE
     99169
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIIE_alpha TFIIE-A_C TF_Zn_Ribbon Elf1
Motif
Other DBs
NCBI-GeneID: 99169
NCBI-ProteinID: NP_001028369
MGI: 2139152
UniProt: Q3TQQ1
Position
2; 2 F1
AA seq 439 aa AA seqDB search
MADPDVLTEVPAALKRLAKYVVRGFYGIEHVLALDILIRNPCVKEEDMLELLKFDRKQLR
SVLNTLKGDKFVKCRMRVETAADGKTTRHNYYFINYRTLVNVVKYKLDHMRRRIEMDERN
STSRASFKCPVCCSTFTDLDANRLFEPTIGTFCCTFCHTEVEENEPAMPKKDARVLLARF
NEQIEPIYALLRETEDVNLAYEILEPEPTAIPALKLSKDRAATASGAAGLAGGCHREAQT
NKAPSYEDLYTQNVVINMDDQDVMHRTSLEGKAAKQRPVWLRESTVPGAYSSEEMKEGGM
DVDTVQEHKQAHAGPDDNEAVMRVLRIHEKKTSSATTAGSVGAEALARAANNSDSESETS
ESDDGFPPRPAAAAPPHHHEDEEDEELEEVAGDPIVMVAGCPFSFSEVSQRPELVAQMTP
EEKEAYIAISQRVFRDLFE
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggcagacccagatgttctcactgaagttccggcggcattgaagcggctagccaagtat
gtcgtcaggggcttttatggcattgagcatgtgttggccttggacatcttgatccggaac
ccctgtgtaaaagaagaggacatgctggagctgctcaagtttgatcggaagcaacttcga
tccgttttgaatactttaaagggagacaagttcgtcaaatgcagaatgagggtagagact
gctgcagatgggaagaccacccgccataactactacttcatcaattaccgcactcttgtt
aatgtagtgaaatataagctggaccacatgagaaggaggattgaaatggatgagagaaat
tccaccagtcgggcttccttcaaatgtcctgtctgctgcagcacgttcactgacctagat
gctaataggctgtttgaacccacgataggaactttctgctgcaccttttgccacacagag
gtagaagaaaatgaaccagcaatgcccaaaaaagatgcccgcgtgcttttggcaagattt
aatgaacaaattgagcccatttatgcattgcttcgagagacagaggatgtcaacttggcc
tatgaaatacttgaaccagaacccacggcaatcccagccctgaagctgagcaaggaccga
gcagcaactgcttctggagctgctggcctggcaggtggatgtcaccgggaggcgcagacc
aacaaagccccctcctatgaggacttgtatactcagaatgttgtcatcaacatggatgac
caagatgttatgcatcgcacctcgctggaagggaaagctgccaaacagagacccgtttgg
ttgagagagagcacggtcccaggggcgtacagttctgaagagatgaaggaaggtggcatg
gatgtggacacagttcaggagcacaagcaagcccacgcagggcctgatgacaatgaggcg
gtcatgcgcgttctacgtattcatgagaaaaagacttcttcggcgaccacagctggctcg
gtgggagcagaggctctggcgagggctgctaataacagtgactctgagagtgagaccagt
gagtcggacgacggctttccaccccggccagcagctgcggctcctcctcatcaccatgaa
gatgaggaagacgaagagcttgaggaagtagcaggtgaccccattgttatggtggctggc
tgtccattttccttcagtgaagttagccagcggccagagctggtagcccagatgacacca
gaagagaaggaagcatacatagccataagtcagcgcgtttttcgggatctctttgagtga

DBGET integrated database retrieval system