KEGG   Mus musculus (mouse): 99296Help
Entry
99296             CDS       T01002                                 

Gene name
Hrh3, AW049250, Eae8, H3R, HH3R
Definition
(RefSeq) histamine receptor H3
  KO
K04151  histamine receptor H3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    99296 (Hrh3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    99296 (Hrh3)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Biogenic amine
   Histamine
    99296 (Hrh3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 DUF621
Motif
Other DBs
NCBI-GeneID: 99296
NCBI-ProteinID: NP_598610
MGI: 2139279
Ensembl: ENSMUSG00000039059
Vega: OTTMUSG00000016256
UniProt: P58406 Q540P3 Q3USH0
Position
2 H4; 2 102.62 cM
AA seq 445 aa AA seqDB search
MERAPPDGLMNASGALAGEAAAAGGARGFSAAWTAVLAALMALLIVATVLGNALVMLAFV
ADSSLRTQNNFFLLNLAISDFLVGAFCIPLYVPYVLTGRWTFGRGLCKLWLVVDYLLCAS
SVFNIVLISYDRFLSVTRAVSYRAQQGDTRRAVRKMALVWVLAFLLYGPAILSWEYLSGG
SSIPEGHCYAEFFYNWYFLITASTLEFFTPFLSVTFFNLSIYLNIQRRTRLRLDGGREAG
PEPPPDAQPSPPPAPPSCWGCWPKGHGEAMPLHRYGVGEAGPGVETGEAGLGGGSGGGAA
ASPTSSSGSSSRGTERPRSLKRGSKPSASSASLEKRMKMVSQSITQRFRLSRDKKVAKSL
AIIVSIFGLCWAPYTLLMIIRAACHGHCVPDYWYETSFWLLWANSAVNPVLYPLCHYSFR
RAFTKLLCPQKLKVQPHGSLEQCWK
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcgcgccgcccgacgggctgatgaacgcgtcgggcgctctggccggagaggcg
gcggctgcaggcggggcgcgcggcttctcggctgcctggaccgctgtcctggctgcgctc
atggcgctgctcatcgtggccacagtgctgggcaacgcgctggtcatgctcgccttcgtg
gcggattcgagcctccgcacccagaacaacttctttctgctcaacctcgccatctccgac
ttcctcgtgggtgccttctgcatcccattgtatgtaccctatgtgctgaccggccgttgg
acctttggccggggcctctgcaagctgtggctggtggtagactacctactgtgtgcctcc
tcagtcttcaacatcgtgctgatcagctatgaccgattcctgtcagtcactcgagctgtc
tcctaccgggcccagcagggggacacaagacgggctgttcggaagatggcactggtgtgg
gtgctggccttcctgctgtatgggcctgccatcctgagttgggagtacctgtccggtggc
agctccatccccgagggccactgctatgctgagttcttctacaactggtactttctcatc
acggcctccaccctcgagttcttcacacccttcctcagcgttaccttcttcaacctcagc
atctacctgaacatccagaggcgcactcgtcttcggctggatgggggccgagaggctggt
ccagaacccccacctgatgcccaaccctcgccacctccagctccccccagctgctggggc
tgctggccaaaggggcacggggaggccatgccattgcacaggtatggggtgggtgaggca
ggccctggtgttgagactggggaggctggcctcgggggtggcagcggtggaggcgctgct
gcctcgcctacctccagctccggcagctcctcaaggggcactgagaggccacgctcactc
aaaaggggctccaagccatcagcgtcttcagcgtccttggagaagcgcatgaagatggta
tcccaaagcatcacccagcgctttcggctgtcgcgggacaagaaggtagccaagtcgctg
gctatcatcgtgagcatctttgggctctgctgggccccgtacacactcctcatgatcatc
cgggctgcttgccatggccactgcgtccccgactactggtacgagacgtccttctggctt
ctgtgggccaactcggccgtcaaccccgtcctctacccactgtgccactacagcttccgt
agagccttcaccaagctcctctgcccccagaagctcaaggtccagccccatggctccctg
gagcagtgctggaagtga

DBGET integrated database retrieval system