KEGG   Mus musculus (mouse): 99371Help
Entry
99371             CDS       T01002                                 

Gene name
Arfgef2, AI463430, AW493672, BIG2, E230011G24Rik
Definition
(RefSeq) ADP-ribosylation factor guanine nucleotide-exchange factor 2 (brefeldin A-inhibited)
  KO
K18442  brefeldin A-inhibited guanine nucleotide-exchange protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    99371 (Arfgef2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    99371 (Arfgef2)
Membrane trafficking [BR:mmu04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    99371 (Arfgef2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec7 Sec7_N DCB DUF1981
Motif
Other DBs
NCBI-GeneID: 99371
NCBI-ProteinID: NP_001078964
MGI: 2139354
Ensembl: ENSMUSG00000074582
Vega: OTTMUSG00000001162
UniProt: A2A5R2
Position
2; 2 H3
AA seq 1792 aa AA seqDB search
MQESQTKSMFVSRALEKILADKEVKRPQHSQLRRACQVALDEIKAELEKQRLGAAAPPKA
NFIEADKYFLPFELACQSKSPRVVSTSLDCLQKLIAYGHITGNAPDSGAPGKRLIDRIVE
TICNCFQGPQTDEGVQLQIIKALLTAVTSPHIEIHEGTILQTVRTCYNIYLASKNLINQT
TAKATLTQMLNVIFTRMENQVLQEARELEKPMQSKPQSPVIQATAGSPKFSRLKQSQAQS
KPTTPEKAELPNGDHAQSGLGKVSLENGEAPRERGSPVSGRAEPSRGTDSGAQEVVKDIL
EDVVTSAVKEAAEKHGLPEPDRALGALECQECAVPPGVDENSQTNGIADDRQSLSSADNL
EPDVQGHQVAARFSHILQKDAFLVFRSLCKLSMKPLGEGPPDPKSHELRSKVVSLQLLLS
VLQNAGPVFRSHEMFVTAIKQYLCVALSKNGVSSVPDVFELSLAIFLTLLSNFKMHLKMQ
IEVFFKEIFLNILETSTSSFEHRWMVIQTLTRICADAQCVVDIYVNYDCDLNAANIFERL
VNDLSKIAQGRSGHELGMTPLQELSLRKKGLECLVSILKCMVEWSKDLYVNPNHQATLGQ
ERLPDQEMGDGKGLDMARRCSVTSVESTVSSGTQTAIQDDPEQFEVIKQQKEIIEHGIEL
FNKKPKRGIQFLQEQGMLGAAVEDIAQFLHQEERLDSTQVGEFLGDSTRFNKEVMYAYVD
QLDFCEKEFVSALRTFLEGFRLPGEAQKIDRLMEKFAARYIECNQGQTLFASADTAYVLA
YSIIMLTTDLHSPQVKNKMTKEQYIKMNRGINDSKDLPEEYLSSIYDEIEGKKIAMKETK
EHTIATKSTKQSVASEKQRRLLYNVEMEQMAKTAKALMEAVSHAKAPFTSATHLDHVRPM
FKLVWTPLLAAYSIGLQNCDDTEVASLCLEGIRCAVRIACIFGMQLERDAYVQALARFSL
LTASSSITEMKQKNIDTIKTLITVAHTDGNYLGNSWHEILKCISQLELAQLIGTGVKTRY
LSGSGREREGSLKGHSLAGEEFMGLGLGNLVSGGVDKRQMASFQESVGETSSQSVVVAVD
RIFTGSTRLDGNAIVDFVRWLCAVSMDELASPHHPRMFSLQKIVEISYYNMNRIRLQWSR
IWHVIGDHFNKVGCNPNEDVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHIMKK
NRSPTIRDMVIRCIAQMVSSQAANIRSGWKNIFAVFHQAASDHDGNIVELAFQTTGHIVS
TIFQHHFPAAIDSFQDAVKCLSEFACNAAFPDTSMEAIRLIRFCGKYVSERPRVLQEYTS
DDMNVAPGDRVWVRGWFPILFELSCIINRCKLDVRTRGLTVMFEIMKSYGHTFAKHWWQD
LFRIVFRIFDNMKLPEQQSEKSEWMTTTCNHALYAICDVFTQFYEALHEVLLSDVFAQLQ
WCVKQDNEQLARSGTNCLENLVISNGEKFSPAVWDETCNCMLDIFKTTIPHVLLTWRPAG
MEEEVSDRHLDVDLDRQSLSSIDRNASERGQSQLSNPTDDSWKGAPYAHQKLLASLLIKC
VVQLELIQTIDNIVFYPATSKKEDAEHMVAAQQDTLDAEIHIETENQGMYKFMSSQHLFK
LLDCLQESHSFSKAFNSNYEQRTVLWRAGFKGKSKPNLLKQETSSLACCLRILFRMYVDE
NRRDSWDEIQQRLLRVCSEALAYFITVNSESHREAWTSLLLLLLTKTLKISDEKFKAHAS
MYYPYLCEIMQFDLIPELRAVLRKFFLRIGLVYKIWIPEEPSQVPAALSSTW
NT seq 5379 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaagccagaccaagagcatgttcgtgtcccgggccctggagaagatcctagct
gacaaggaggtgaagcggccccagcactcccagctgcgtagggcctgccaggtggcgctc
gatgaaattaaagcagaactagaaaagcagaggcttggcgctgcggctccaccaaaggca
aacttcattgaagctgacaagtatttccttccattcgagctggcctgccaatccaagtca
cctcgggtggtcagcacatccctggactgcttgcagaaactcatcgcatatggacacatc
actggcaatgcccctgacagtggcgctcctgggaagcggctgatcgacaggatcgttgaa
accatttgcaattgttttcagggccctcagacagatgaaggggttcagctacaaatcatt
aaggctctgctgactgctgtgacatccccacacattgaaatccatgagggcaccatcctg
cagacagtgaggacctgctacaatatctatctggccagcaaaaacctcatcaatcaaacc
accgccaaggccacccttacccaaatgctgaatgtcatcttcacccgcatggaaaaccaa
gtgttacaggaggccagagaattggaaaaaccaatgcagtcaaaacctcagtccccggtg
atccaggccacagcaggctctcccaagttcagccgcctgaagcagagccaggcccagagc
aaacccacgactcctgagaaagcagagctgcccaatggggaccatgcccagagtggccta
ggaaaagtgagcttggaaaatggagaagctccccgagagagaggctcgccagtctctggg
agagccgagccttcgaggggcactgacagtggagctcaggaggtggtgaaggacatctta
gaggacgtggtcacgtctgctgtgaaagaagcagcagaaaagcatggtctgccggagccc
gaccgagccctgggtgccctagagtgccaggaatgcgctgttcctcctggagttgatgaa
aactcacagaccaacggcatagcagacgacaggcagtcgctatcctccgcagataatctg
gaaccagatgttcaaggacaccaagtggctgctaggttctctcacattctacagaaggat
gccttcctggtgttccgctccctgtgcaagctgtccatgaagccccttggggaagggcca
ccagatccaaagtcccacgagcttcgttccaaggtggtttccctgcagctgctcctctct
gtgctgcagaatgctggcccagtcttcaggagccacgagatgttcgtcactgccattaag
cagtacctgtgtgtggccctttccaagaatggcgtgtcctcagtgcctgacgtcttcgaa
ctctcgcttgctatttttcttactcttctttcaaacttcaagatgcacttgaaaatgcag
atagaggtctttttcaaagagattttcctgaacattttagaaacatccacaagttctttt
gagcaccgctggatggtcattcagaccctgacgaggatttgtgcagatgcccagtgcgtt
gtggatatttatgtcaactacgactgtgacttaaatgctgctaacattttcgagcgacta
gtaaatgacttatccaaaattgctcagggaagaagtggacatgagctggggatgacacct
ctacaggagctcagtctgaggaagaaaggcctggagtgtctggtgtctattctcaagtgc
atggtggagtggagcaaggacctgtatgtgaatcccaaccaccaggctaccctgggtcag
gagaggctcccagatcaggaaatgggggacggaaaaggccttgacatggcaagacggtgc
agcgtgacatccgtggagtccacagtgtcctcggggacccagacagccattcaggatgac
ccagagcagtttgaggtcatcaaacaacagaaggaaatcattgagcatggcattgagctc
ttcaataagaagcccaagcgaggtatccagtttctccaagagcaaggcatgctgggagca
gctgtagaagatattgcccaatttctgcaccaggaggagcggctggattctacccaggtt
ggcgagtttctgggagacagcacgaggtttaacaaggaggtgatgtatgcctatgtggac
caactggatttctgtgaaaaagagttcgtctcagccctgaggacattcctggagggcttc
cgcctgcctggggaagcccagaagattgaccggttaatggagaagtttgctgcacgatac
atagaatgtaaccaagggcaaaccctgtttgctagtgcggacactgcgtatgtcctggcg
tactccatcatcatgctgaccacagacctgcacagcccacaggtaaagaataagatgaca
aaagagcagtatattaaaatgaaccggggcatcaacgacagcaaagacctgcctgaggag
tacctgtccagcatctatgacgagatagagggcaagaagatagcgatgaaggagacaaag
gagcacacaattgcgaccaagtccaccaagcagagtgtagctagtgaaaagcagaggcgg
ctgctgtacaatgtggagatggagcagatggctaaaacagccaaagctctgatggaggcc
gtgagccatgccaaagccccgtttaccagcgccacacacttggaccatgtccggccaatg
ttcaaactggtgtggacgccgctgctggcagcctatagtattggcctgcagaactgtgat
gacacggaggtggcctccctgtgtttggaaggcatcaggtgtgcagtccgcattgcctgc
atctttggaatgcagctggaacgagatgcctatgttcaggcccttgctcgcttttccctg
ctgacagccagctccagcatcacagaaatgaagcagaaaaacatcgacaccataaagaca
ctcatcactgtggctcacaccgatggcaactaccttggcaactcctggcatgagatcttg
aagtgcatcagccagctggagcttgctcagctgataggaactggggtgaagactcgctac
ctctctggctctgggcgggaacgagaagggagcctgaagggccacagtctggcaggagaa
gaattcatgggtcttggcctcggtaacttggtgagtggtggtgtagacaaaagacagatg
gccagcttccaggagtcggttggtgaaacaagctcacagagtgtggttgtcgcagttgac
agaatttttactggctctaccagactggatggaaatgcaatagttgactttgtccgttgg
ctgtgtgctgtgtccatggatgagctggcttctccccaccatcctcgaatgttcagcctg
cagaagattgtggaaatatcatactacaacatgaacaggatccggctgcagtggtctcgg
atatggcatgtcattggagatcacttcaataaggtcggctgtaaccccaatgaagatgtg
gccatcttcgcagttgactctctgcggcagctctccatgaagttcctggagaagggagaa
ttagccaacttccgatttcagaaggattttctgaggccatttgaacatattatgaagaaa
aacaggtccccgaccatccgggacatggtgatccgatgcatcgctcagatggtgagctcc
caggcagccaacatccgctcaggctggaagaacatctttgctgtgttccaccaggctgcc
tctgaccacgatgggaacattgtggagctggccttccaaaccacaggccacatcgtctca
accatcttccagcaccacttccctgcagccatcgactccttccaggatgctgtgaagtgc
ttgtctgagttcgcctgcaatgcagctttccctgacaccagcatggaggccatccggctc
atccgcttctgtgggaaatacgtctcagagaggcctcgggtgctgcaagagtacacaagt
gatgatatgaatgtggctcctggtgacagggtctgggtcagaggctggtttcccatcctg
tttgaactctcctgcatcattaacagatgcaagttagatgtacgcacaaggggactcacg
gtcatgtttgagattatgaagagctatggccacacctttgcaaagcactggtggcaggac
ctgttcagaatcgtgtttcgaatttttgacaacatgaaactccctgagcaacagtcagag
aaatcagagtggatgacgaccacgtgcaatcatgcactgtacgctatttgtgacgtattc
acccagttctacgaagctttgcatgaagtgcttctctctgatgtgtttgcgcagctgcag
tggtgcgtgaaacaagataatgagcagttggcccgatcaggtacgaactgcttagagaac
ctagtgatatccaacggcgagaagttcagccctgctgtctgggatgaaacctgcaattgc
atgttggatattttcaaaaccaccatcccacatgttttgctgacgtggagacctgcgggg
atggaggaggaggtgtcagatagacatctggatgtggacctagaccgccagtctttaagc
agcatagacagaaacgcctccgagagaggacagagccagctgtccaaccccactgacgac
agctggaagggggcaccgtatgcacatcagaaactgctggccagcctcctcatcaagtgt
gtggttcagctggagctgatccagaccattgacaacatcgtgttctaccctgccaccagc
aagaaggaggatgcggagcacatggttgctgcccagcaagacaccctcgatgcagagatc
cacatcgagacggagaatcagggcatgtacaagttcatgtcctcccagcacctcttcaag
ctgctggactgcctgcaggagtcccactccttctccaaagccttcaactccaactatgag
cagcggactgtcctctggcgagctggcttcaagggcaagtccaaacccaatcttctcaaa
caagaaaccagcagcctggcctgttgtctaaggatcctgtttagaatgtacgttgatgag
aaccgcagggattcctgggacgaaatacagcagcgacttctaagagtgtgcagtgaagca
cttgcctatttcattactgtgaactccgagagccatcgggaagcatggacgagcctcctg
ctgctacttctaaccaaaaccctcaagataagcgatgaaaagttcaaagcacacgcgtca
atgtactacccctacctgtgtgaaattatgcagtttgacctgatccctgagctccgagca
gttctgcgaaagttcttcctgcggataggcctggtgtataagatatggattccagaagag
ccgtcgcaagtgccagcagcactgtcatcgacctggtag

DBGET integrated database retrieval system