KEGG   Mus musculus (mouse): 99375
Entry
99375             CDS       T01002                                 

Gene name
Cul4a, 2810470J21Rik, AW495282
Definition
(RefSeq) cullin 4A
  KO
K10609  cullin 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03420  Nucleotide excision repair
mmu04120  Ubiquitin mediated proteolysis
mmu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    99375 (Cul4a)
  09124 Replication and repair
   03420 Nucleotide excision repair
    99375 (Cul4a)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    99375 (Cul4a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    99375 (Cul4a)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    99375 (Cul4a)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    99375 (Cul4a)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Cullin
     99375 (Cul4a)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      99375 (Cul4a)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      99375 (Cul4a)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   99375 (Cul4a)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 SecA_SW PTPS
Other DBs
NCBI-GeneID: 99375
NCBI-ProteinID: NP_666319
MGI: 1914487
Ensembl: ENSMUSG00000031446
Vega: OTTMUSG00000030982
UniProt: Q3TCH7
Position
8; 8 A1.1
AA seq 759 aa
MADEGPRKGSVSALMGRTNGLTKPAALAGGPAKPGGTGGSRKLVIKNFRDRPRLPDNYTQ
DTWRKLHEAVKAIQSSTSIRYNLEELYQAVENLCSHKVSPTLYKQLRQVCEDHVQAQILP
FREDSLDSVLFLKKINTCWQDHCRQMIMIRSIFLFLDRTYVLQNSMLPSIWDMGLELFRN
HIISDRMVQSKTIDGILLLIGRERSGEAVDRSLLRSLLSMLSDLQVYKDSFELKFLEETN
CLYAAEGQRLMQDREVPEYLNHVSKRLEEEADRVITYLDHSTQKPLIACVEKQLLGEHLT
AILQKGLEHLLDENRVPDLTQMYQLFSRVKGGQHALLQHWSEYIKTFGTTIVINPEKDKD
MVQDLLDFKDKVDHVVEVCFQRNERFINLMKESFETFINKRPNKPAELIAKHVDSKLRAG
NKEATDEELERILDKIMILFRFIHGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLK
HECGAAFTSKLEGMFKDMELSKDIMVHFKQHMQNQSAPGPIDLTVNILTMGYWPTYTPME
VHLPPEMVRLQEVFKTFYLGKHSGRKLQWQTTLGHAVLKADFKEGKKEFQVSLFQTLVLL
MFNEGDGFSFEEIKMATGIEDSELRRTLQSLACGKARVLIKSPKGKEVEDGDKFIFNADF
KHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELY
NQLKFPVKPGDLKKRIESLIDRDYMERDKDSPNQYHYVA
NT seq 2280 nt   +upstreamnt  +downstreamnt
atggcggacgagggccctcggaagggcagcgtctcggctctcatgggccgcaccaacggc
ctcaccaagcccgcggcgttggccggtggccccgccaagccggggggcacgggaggctcc
aggaagctggtcatcaagaacttccgagacaggccgcggctgcctgacaactacactcag
gacacgtggcggaagcttcacgaagcggtcaaggccatccagagcagcacatccatcagg
tacaacctggaggagctgtaccaggctgttgaaaatctttgttctcacaaagtctcccca
acgctctacaagcagctgcgccaggtctgtgaagaccatgtccaggcccagatcctccca
ttcagagaagactcactagacagcgttttatttctaaagaagattaacacatgctggcaa
gatcactgcagacaaatgatcatgatcagaagcatcttcctgtttctggatcgaacctac
gtcctccagaattccatgctgccttctatctgggacatgggcctagagctgtttaggaac
cacatcatcagcgacaggatggtgcagagtaagaccattgatgggatcctgctgctgatt
gggcgtgaacgaagtggagaggctgtggacaggagtctgcttcggagtttgctaagcatg
ctctcagatctccaggtgtacaaagactcatttgagctgaagttcttggaagagactaac
tgtctatacgctgctgaaggccagaggctgatgcaggacagggaggttccagaatacctt
aaccatgtgagcaaacgtctagaagaggaagcagaccgagtgatcacctacttagaccac
agcacacaaaaaccgttgattgcctgtgtggagaaacagctgttaggagaacatttgaca
gcaattctacagaaaggcctagagcacctgctggatgagaacagggtgcccgacctcacc
cagatgtaccagctcttcagccgggtgaaaggagggcagcatgcgctgctgcagcactgg
agcgagtacatcaagacctttggaacaaccattgtcatcaatcctgagaaagacaaagac
atggtccaagacctgctggactttaaggacaaagtggaccacgtggtggaggtgtgcttc
cagaggaacgagcgcttcatcaacctgatgaaggagtccttcgagacgttcatcaacaag
agaccaaacaagcctgcagagctcattgccaagcacgtggactcaaagttacgggccggc
aacaaagaagccacagatgaggaactggagaggatcctggacaagatcatgattctcttc
cgtttcatccatggtaaagatgtctttgaagcgttttataagaaagacttagcaaaaagg
ctgctggtggggaagagcgcgtcggtggacgcggagaagtccatgctgtcgaagctcaag
cacgagtgcggagctgcgtttaccagcaaactggagggcatgttcaaggacatggagctc
tccaaagacatcatggttcacttcaagcagcatatgcagaaccagagtgcgccaggcccc
attgacctcacggtgaacatactcaccatgggctactggcccacgtacacacccatggaa
gtgcacctccctccagagatggtcagacttcaggaagtattcaagacgttctacctgggc
aagcacagtgggcggaagctgcaatggcagacaacgctgggacacgccgtgctgaaggcg
gactttaaggaggggaagaaggagttccaggtatccctcttccagacgctggtgctgctc
atgttcaacgaaggggatggatttagctttgaagaaataaaaatggccactggcatagag
gacagtgagttgcgaagaacactacagtctctggcctgtggtaaagcacgggtcctaatt
aaaagtcccaaaggaaaggaggtggaagatggagataagttcatcttcaatgcagacttc
aaacacaagttgttcagaataaagatcaatcaaatccagatgaaggagaccgttgaagaa
caggttagcactacagagagagtattccaggatagacagtaccagatcgacgctgctata
gtcagaataatgaaaatgaggaagacacttggtcataatcttctagtttctgaattatac
aatcagctgaaatttccagtgaagcctggagatttgaaaaaaaggattgagtcacttata
gacagagactatatggaacgagacaaagacagtccaaatcagtaccactacgtggcatga

DBGET integrated database retrieval system