KEGG   Mus musculus (house mouse): 99377
Entry
99377             CDS       T01002                                 
Symbol
Sall4, 5730441M18Rik, C330011P20Rik, Tex20
Name
(RefSeq) spalt like transcription factor 4
  KO
K19871  sal-like protein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    99377 (Sall4)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    99377 (Sall4)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-met zf-C2H2_jaz zf-C2H2_6 zf-Di19 DUF3268 zf-C2H2_11 DUF2225
Other DBs
NCBI-GeneID: 99377
NCBI-ProteinID: NP_780512
MGI: 2139360
Ensembl: ENSMUSG00000027547
UniProt: Q8BX22 Q9CYI8
Position
2:complement(168590252..168609121)
AA seq 1067 aa
MSRRKQAKPQHINWEEGQGEQPQQLPSPDLAEALAAEEPGAPVNSPGNCDEASEDSIPVK
RPRREDTHICNKCCAEFFSLSEFMEHKKSCTKTPPVLIMNDSEGPVPSEDFSRAALSHQL
GSPSNKDSLQENGSSSGDLKKLGTDSILYLKTEATQPSTPQDISYLPKGKVANTNVTLQA
LRGTKVAVNQRGAEAPMAPMPAAQGIPWVLEQILCLQQQQLQQIQLTEQIRVQVNMWAAH
ALHSGVAGADTLKALSSHVSQQVSVSQQVSAAVALLSQKASNPALSLDALKQAKLPHASV
PSAASPLSSGLTSFTLKPDGTRVLPNFVSRLPSALLPQTPGSVLLQSPFSAVTLDQSKKG
KGKPQNLSASASVLDVKAKDEVVLGKHKCRYCPKVFGTDSSLQIHLRSHTGERPYVCPIC
GHRFTTKGNLKVHLQRHPEVKANPQLLAEFQDKGAVSAASHYALPVPVPADESSLSVDAE
PVPVTGTPSLGLPQKLTSGPNSRDLMGGSLPNDMQPGPSPESEAGLPLLGVGMIHNPPKA
GGFQGTGAPESGSETLKLQQLVENIDKATTDPNECLICHRVLSCQSSLKMHYRTHTGERP
FQCKICGRAFSTKGNLKTHLGVHRTNTTVKTQHSCPICQKKFTNAVMLQQHIRMHMGGQI
PNTPLPESPCDFTAPEPVAVSENGSASGVCQDDAAEGMEAEEVCSQDVPSGPSTVSLPVP
SAHLASPSLGFSVLASLDTQGKGALPALALQRQSSRENSSLEGGDTGPANDSSLLVGDQE
CQSRSPDATETMCYQAVSPANSQAGSVKSRSPEGHKAEGVESCRVDTEGRTSLPPTFIRA
QPTFVKVEVPGTFVGPPSMPSGMPPLLASQPQPRRQAKQHCCTRCGKNFSSASALQIHER
THTGEKPFVCNICGRAFTTKGNLKVHYMTHGANNNSARRGRKLAIENPMAALSAEGKRAP
EVFSKELLSPAVSVDPASWNQYTSVLNGGLAMKTNEISVIQSGGIPTLPVSLGASSVVSN
GTISKLDGSQTGVSMPMSGNGEKLAVPDGMAKHQFPHFLEENKIAVS
NT seq 3204 nt   +upstreamnt  +downstreamnt
atgtcgaggcgcaagcaggcgaagccccagcacatcaactgggaggagggccagggcgag
cagcctcagcagctaccgagccccgacctcgccgaggcgctggcggcggaggaacccggt
gctccagtgaactcccctgggaactgcgatgaagcctcagaggactccataccggtgaag
cggccccggcgggaggacactcacatctgcaacaaatgctgtgccgagttctttagtctc
tctgaattcatggaacacaagaaaagttgcactaaaacccctcctgtcctcatcatgaat
gacagcgaggggccagtgccttcagaggacttttccagagctgccctgagccaccagctg
ggcagcccaagcaataaagacagtctccaggagaacggcagcagctcgggggacttgaag
aagctgggcacggactccatcctgtacttgaagacagaggctacccagccatccacaccc
caggacataagctatttacccaaaggcaaagtagccaacaccaatgtgactctgcaggcg
ctccgcggcaccaaggtggccgtgaaccaacggggtgcagaggcacccatggcgcccatg
cctgctgcccaaggcatcccttgggtcctggagcagatcctgtgcctgcagcagcagcaa
ctccagcaaatccagcttacggaacagattcgcgtccaggtgaacatgtgggcagcgcac
gcgctccactctggagtggcgggggccgacacgctgaaggccttaagcagccatgtgtct
cagcaagtgtccgtgtcccagcaggtgtcggctgccgtggccctgctcagccagaaagcc
tcaaacccagctctgtcgctcgatgccttgaaacaagccaagctacctcatgccagcgtc
ccctccgcagccagcccgttgtcctcggggttaacgtccttcaccttgaagcctgacggg
acacgggttctccccaacttcgtgtctcgccttcccagtgccctgctacctcagactccg
ggctctgtgctcctgcagagtcccttctccgctgtgacgctcgaccagtccaagaaagga
aaggggaaaccccagaacctctccgcctctgcctcggtgttagatgtcaaggccaaggac
gaagtcgtcctcggtaagcacaagtgtaggtactgtcccaaggttttcgggacagatagc
tcccttcagattcaccttcgctcccacaccggagagagaccttacgtgtgccctatctgt
ggtcaccgcttcaccaccaagggcaatctcaaggtccacttacaacgacaccctgaggtg
aaggcaaacccccagctgttggccgaattccaggacaaaggggcagtgagtgccgcttct
cactatgcactccctgtccccgtccctgccgatgaatcgagtctctctgtagacgccgag
cctgtcccggtcacgggaaccccttctctagggctacctcaaaagctcacgtcagggcct
aattccagggacctcatgggtggctccttgcccaatgacatgcagccagggccttctcca
gaaagtgaggcgggccttccactccttggggtggggatgatacataatcccccaaaggct
gggggcttccagggcactggggccccagagtcagggtccgagaccctgaaattgcagcaa
ctagtggagaacatagacaaggccactactgaccccaacgagtgtctcatttgtcatcgg
gtcctcagctgtcagagttccctgaagatgcattaccgtacccacacaggggagagacca
ttccagtgcaagatctgtggccgggccttctccaccaaaggcaacctgaagacacacctt
ggggttcaccgaaccaacacgaccgtaaagacccaacattcgtgccccatctgccagaag
aaattcaccaacgccgtcatgttacagcagcatatccggatgcacatgggtggccagatc
cccaacacccctctgccagagagtccctgtgacttcacggctcccgagcccgtggccgtc
agtgagaatggcagtgccagcggggtctgccaggacgacgcagcagaagggatggaagcc
gaggaggtctgttctcaggatgttcccagtggcccctcaactgtctctctgccggttccc
agtgcccacctggcatcgccctctctgggcttctctgtgttggcctccctggatacgcag
gggaaaggggctcttccggcgctggccctgcagaggcagagcagtcgagaaaacagctcc
ctggagggcggtgacactggtccagccaatgactcttccttgctcgtgggtgaccaggag
tgtcagagccgaagcccagatgccacggagaccatgtgctaccaggcagtgtcacctgcc
aatagccaagccggaagtgtcaagtcccggtctcccgagggtcacaaggccgagggcgtg
gagagctgccgcgttgacaccgaaggtcgtaccagcctccctccaacatttatccgagca
cagcccacctttgtcaaagttgaagtgcctggcacctttgtgggaccccccagcatgccc
tcgggtatgccgcctttgctagcatcgcagccgcagccacgccgccaggccaagcagcac
tgctgcacacggtgtggaaagaacttctcgtctgccagtgccctgcagatccacgagcga
acacacacgggagagaagcctttcgtgtgtaacatatgcgggcgggccttcaccacgaaa
ggcaacctgaaggtacactacatgactcatggggccaacaataactccgcccgccgggga
aggaagctggccatagagaaccccatggccgcgctgagtgctgagggaaagagagcgccc
gaggtgttttccaaggagctcctgtcccccgcggtgagtgtggaccccgcctcctggaac
cagtacaccagcgtcctgaatgggggtctggccatgaagaccaacgagatctccgtgatc
cagagcggaggcatccccacgctgcctgtgtcgctgggggccagctctgtggtgagcaat
ggcacgatttccaagcttgacggctctcagaccggtgtgagcatgcccatgagcgggaac
ggagaaaagctcgctgttcccgacggcatggccaaacaccagttccctcacttcctggag
gaaaataagattgctgtcagctaa

DBGET integrated database retrieval system