KEGG   Mus musculus (mouse): 99382Help
Entry
99382             CDS       T01002                                 

Gene name
Abtb2, AW539457, BPOZ-2
Definition
(RefSeq) ankyrin repeat and BTB (POZ) domain containing 2
  KO
K10521  ankyrin repeat and BTB/POZ domain-containing protein 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    99382 (Abtb2)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     99382 (Abtb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BTB Ank_2 Ank_3 Ank_4 Ank Ank_5 BACK
Motif
Other DBs
NCBI-GeneID: 99382
NCBI-ProteinID: NP_849221
MGI: 2139365
Ensembl: ENSMUSG00000032724
Vega: OTTMUSG00000014876
UniProt: Q7TQI7 Q3T9J9
Position
2; 2 E2
AA seq 1024 aa AA seqDB search
MAGTYSSTLKTLEDLTLDSGYGAGDSCRSLSLSSSKSNSQALNSSAQQHRGAAWWCYSGS
MNSRHNSWDTVNTVLPEDPEVADLFSRCPRLPELEEFPWTEGDVARVLRKSVGGRRLPSF
SAEAVRRLAGLLRRALIRVAREAQRLSVLHAKCTRFEVQSAVRLVHSWALAESCALAAVK
ALSLYSMSAGDGLRRGKSARCGLTFSVGRFFRWMVDTRISVRIHEYAAISLTACMENLVE
EIRARVLASQSPDGGGAGGGEVSAEALEMVINNDAELWGVLQPYEHLICGKNANGVLSLP
AYFSPYNGGSLGHDERADAYAQLELRTLEQSLLATCVGSISELSDLVSRAMHHMQGRHPL
CPGTSPARQARQPPQPITWSPDALHTLYYFLRCPQMESMENPNLDPPRMTLNNERPFMLL
PPLMEWMRVAITYAEHRRSPTVDSGDIRQAARLLLPGLDCEPRQLKPECCFSSFRRLDAR
AATERFNQDLGFRMLNCGRTDLISQAIEALGPDGVNTMDDQGMTPLMYACAAGDEAMVQM
LIDAGANLDIQVPSHSPRHPSVHPDSRHWTSLTFAVLHGHISVVQLLLDAGAHVEGSAVN
SGEDSYAETPLQLASAAGNYELVSLLLSRGADPLLSMLEANGMASSLHEEMNCFSHSAAH
GHRNVLRKLLTQPQQAKADVLSLEEILAEGVEESDTSSQGSSEGPVRLSRTRTKALQEAM
YYSAEHGYLDITMELRALGVPWKLHIWIESLRTSFSQSRYSVVQSLLKDFSSIKEEEYNE
ELVTEGLQLMFDILKTSKNDSVLQQLATIFTHCYGTSPIPSIPEIRKTLPARLDPHFLNN
KEMSDVTFLVEGKLFYAHKVLLVTASNRFKTLMTNKSEQDGDSSKTIEISDIKYHIFQML
MQYLYYGGTESMEIPTADILQLLSAANLFQLDALQRHCEILCSQTLSVESAVNTYKYAKI
HNAPELALFCEGFFLKHMKALLEQDAFRQLIYGRSSKVQGLDPLQDLQSTLAERVHSVYV
TSRV
NT seq 3075 nt NT seq  +upstreamnt  +downstreamnt
atggccgggacatacagctccacattgaagactctggaggacttgaccttggactccggg
tatggggccggcgactcctgccgctcgctcagcctttcgtcttccaagtccaactcgcag
gcgctcaactcttcggcgcagcagcaccgcggggcggcctggtggtgctactccggctcc
atgaacagccgccacaacagctgggacacggtgaacacagtgctgcccgaggatcccgaa
gtggccgacctcttctcccgctgcccgcggctcccggagctggaggagttcccttggacc
gagggagacgtggcccgggtgctccgcaaaagcgtcggcggccggaggctgccctcgttc
tccgccgaggctgtgagacgcttggccggactcctccgccgggcgctcatccgcgtggcc
cgggaggcgcagcgccttagcgtgctgcacgctaagtgcacccgcttcgaggtgcagagt
gcggtgcgcctggtgcacagctgggcgctggccgagagctgcgcactggcagcggtcaag
gcgttgtccctctacagcatgagcgctggggatgggctgcgccgcggcaagtcggcgcgc
tgcggcctcactttctccgtgggccgcttcttccgttggatggtggacactcgcatctcc
gtgcgcatccatgagtacgcggccatctcgctaacggcttgcatggagaacctggtggag
gagatccgggccagggtgctggcgagccagagcccagatggcggaggggcaggaggtgga
gaggtatccgctgaggccttggagatggtcatcaacaacgacgccgagctctggggagtc
ctgcaaccctatgagcatctcatctgtggcaagaacgccaatggtgtcctctctctccct
gcctacttcagtccctacaatggtgggtccctgggccacgatgagcgagcagatgcctat
gctcagctggaacttcggacactggagcagtcactcctggccacgtgtgtgggcagcatc
tccgagctcagtgatctggtctctcgagccatgcaccacatgcagggccgccaccccctg
tgcccaggcaccagccctgctcgccaggcccgccagccaccacagcccatcacgtggtcc
cccgatgctctccacacactctactacttcctgaggtgtccacagatggagtccatggag
aaccccaacctggatcccccaagaatgactctgaataatgaacggcccttcatgctgctg
ccaccgctgatggagtggatgcgggttgcaatcacctatgcagaacaccgtcgcagcccc
actgtggacagtggcgatatccggcaggcagcccggctactgctgccaggcctggactgt
gagccccggcaactcaaacccgagtgctgcttcagttccttccggaggctggatgctcga
gctgctactgaacgcttcaaccaggacctgggcttccgcatgctcaactgtgggagaaca
gacctcatcagccaggccatcgaggccctgggcccggatggggtgaacacaatggatgac
cagggtatgacgccgcttatgtacgcctgtgctgctggggacgaagccatggtccagatg
ctgattgatgctggagctaacttagatatccaggttccaagccactctcccaggcatccg
tccgtccaccccgacagcaggcattggacctccctgacatttgcggtgctacatggacac
atctctgtggtgcagctgctacttgatgccggtgcccatgtggagggctcagctgtgaac
agtggggaggacagctacgccgagacacccctgcagctggcctctgcagccgggaactat
gagctggtcagcttgctgctgagccggggtgctgaccccctcctcagcatgctggaagcc
aacggcatggcatcttccctccacgaggagatgaactgcttcagccactccgctgcccac
ggccacagaaatgtcctgagaaagctcctgactcagccacagcaggctaaagcagatgtg
ctgtctctagaagagatcctggctgagggtgtggaggaaagcgacacatcgagccagggc
agcagtgaggggcctgtgaggctaagccgaacccgaacgaaggccctgcaggaagccatg
tactacagcgctgagcacggttacctggacatcaccatggagctgagggcactgggtgtt
ccctggaagctgcacatctggatagagtcgctgcggacctccttctcacagtcacggtac
tcagtggtgcagagcctcctgaaggatttcagctccatcaaggaagaggagtacaacgag
gagctggtgacagaaggcttgcagctcatgtttgatatcctcaagaccagcaaaaacgac
tccgtcctccagcagctggccaccatcttcacacactgctatggcaccagccccatcccc
agcatcccggagatccggaagaccctgccagccaggctagatcctcactttctgaacaac
aaggagatgtctgatgtaaccttcctagtggaaggaaagctgttttatgcacacaaagtc
cttttggtgacagcatctaacaggttcaagaccttaatgaccaacaaatcagaacaagat
ggggacagcagcaaaaccattgagatcagcgacatcaagtaccacatctttcagatgctg
atgcagtacctgtactacggaggaaccgagtccatggaaatccccactgctgacatcctg
cagctgctgtcagctgccaacctgttccagctagatgccctgcagagacactgtgagatc
ctgtgctcccagacccttagtgtggaaagtgctgtcaacacctacaaatatgccaagatc
cacaacgccccggagctggccctcttctgtgaaggcttcttcctcaagcacatgaaggcc
ctgctagagcaggatgccttccggcagctcatctatggccgaagcagcaaagtccagggc
ctggacccactgcaggatctgcagagcaccctagcagagcgagtgcattctgtctacgtc
acctcccgggtgtga

DBGET integrated database retrieval system