KEGG   Mus musculus (mouse): 99439Help
Entry
99439             CDS       T01002                                 

Gene name
Duox1, 9930101G15Rik, AW987690, Duox2, LNOX1, LNOX2, NOXEF1, NOXEF2, P138-TOX, THOX1, THOX2
Definition
(RefSeq) dual oxidase 1
  KO
K13411  dual oxidase [EC:1.6.3.1 1.11.1.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    99439 (Duox1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.3  With oxygen as acceptor
    1.6.3.1  NAD(P)H oxidase (H2O2-forming)
     99439 (Duox1)
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.-  
     99439 (Duox1)
Membrane trafficking [BR:mmu04131]
 Others
  NADPH oxidases (Nox) and associated proteins
   NADPH oxidases
    99439 (Duox1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase NAD_binding_6 Ferric_reduct FAD_binding_8 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_7 EF-hand_5 NAD_binding_1
Motif
Other DBs
NCBI-GeneID: 99439
NCBI-ProteinID: NP_001092767
MGI: 2139422
Ensembl: ENSMUSG00000033268
Vega: OTTMUSG00000015570
UniProt: A2AQ92
Position
2; 2 E5
AA seq 1551 aa AA seqDB search
MGFHLALAWILLVGTLASLGAQNSISWEVQRFDGWYNNLMEHRWGSKGSRLQRLVPASYA
DGVYQPLKEPYLPNPRHLSNRVMRGSAGQPSLRNRTVLGVFFGYHVLSDLVSVETPGCPA
EFLNIYIPHGDPVFDPDKRGNVVLPFQRSRWDRNTGQSPSNPRDQSNQVTGWLDGSAIYG
SSHSWSDTLRSFSGGQLASGPDPAFPSDSQSSLLMWMAPDPSTGQGGPRGVYAFGAQRGN
REPFLQALGLLWFRYHNLCARKLAQEHPHWGDEELFQHARKRVIATYQNIAMYEWLPSFL
KQTPPEYPGYRPFLDPSISPEFVVASEQFLSTMVPSGVYMRNASCHFQGIPSHNSSVSGA
LRVCNSYWSREHPKLQRAEDVDALLLGMASQIAEREDHVVVEDMQDFWPGPLKFSRTDYL
ASCLQRGRDLGLPSYTKAREALGLSPISHWQDINPALSRSNGTVLEATAALYNQDLSRLE
LLPGGLLESHGDPGPLFSTIVLDQFVRLRDGDRYWFENTRNGLFSKEEIAEIRNTSLRDI
LVAVTNVDPSALQPNVFFWLAGDPCPQPSQLSAKGLPACAPLFIRDYFEGSGFGFGLTIG
TLCCFPLVSLLSAWIVARLRKRNFKRLQRQDRQSIMSEKLVGGVEALEWQGRNEPCRPVL
VHLQPGQIRVVDGRLTVLRTIQLRPPQQVNLILSSNRGRRTLLLKIPKEYDLVLLFNMEE
ERQALVENVRGALKENGLSFQEWELREQELMRAAVTRQQRGHLLETFFRHLFSQVLDINQ
ADAGTLPLDSSTKVREALTCELSRAEFADSLGLKPQDMFVESMFSLADKDGNGYLSFREF
LDILVVFMKGSPEEKSRLMFRMYDFDGNGLISKDEFIRMLRSFIEISNNCLSKAQLAEVV
ESMFRESGFQDKEELTWEDFHFMLRDHDSDLRFTQLCVKGVEVPEVIKNLCRRASYISQE
KICPSPRMSAHCARNNMKTASSPQRLQCPMDTDPPQEIRRRFGKKVTSFQPLLFTEAHRE
KFQRSRRHQTVQQFKRFIENYRRHIGCVAVFYTITGALFLERAYYYAFAAHHSGITDTTR
VGIILSRGTAASISFMFSYILLTMCRNLITFLRETFLNRYIPFDAAVDFHRLIASTAIIL
TVLHSAGHVVNVYLFSISPLSVLSCLFPGLFHDDGSEFPQKYYWWFFQTVPGLTGVLLLL
ALAIMYVFASHHFRRRSFRGFWLTHHLYIFLYILLIIHGSFALIQMPRFHIFFLVPAIIY
VGDKLVSLSRKKVEISVVKAELLPSGVTHLRFQRPQGFEYKSGQWVRIACLALGTTEYHP
FTLTSAPHEDTLSLHIRAAGPWTTRLREIYSPPTGDTCARYPKLYLDGPFGEGHQEWHKF
EVSVLVGGGIGVTPFASILKDLVFKSSVSCQVFCKKIYFIWVTRTQRQFEWLADIIREVE
ENDRQDLVSVHIYITQLAEKFDLRTTMLYICERHFQKVLNRSLFTGLRSITHFGRPPFEP
FFNSLQEVHPQVRKIGVFSCGPPGMTKNVEKACQLINRQDRTHFSHHYENF
NT seq 4656 nt NT seq  +upstreamnt  +downstreamnt
atggggttccacttagctctggcctggattctcctggttgggacactggcttctttggga
gctcagaactccatttcttgggaggtacagcgatttgatggatggtataacaacctcatg
gagcacagatggggcagcaaaggctctcggctgcagcgccttgttccagccagctatgca
gatggtgtctaccagcccctgaaagaaccctacctgcctaacccccgacaccttagtaac
agggtcatgagaggttctgcagggcagccatctcttcggaaccgtacagtcctgggtgtc
ttctttggctaccacgtgctctcagacctggtgagtgtggaaacaccaggctgccccgca
gagttcctcaacatttacatcccgcatggggacccggtgttcgaccctgacaagcgcggg
aacgtggtgctgccctttcaaaggagccgctgggaccgcaacactggacagagccccagc
aacccccgggaccagagcaaccaggtgaccggctggctagatggcagcgccatctatggc
tcctctcattcctggagtgacactctgaggagcttctctggaggacagctggcttctggg
cctgaccctgctttcccatcggactcccagagctctctgctcatgtggatggcgccggac
ccctccacagggcagggagggccacggggggtgtatgccttcggggcccagcgcgggaac
agggagccctttctgcaggctctgggcttgttgtggtttcgctaccacaacctgtgtgcc
aggaagctggcgcaggagcacccgcactggggggatgaggaactgttccagcatgctcgc
aagagggtcattgccacctaccagaacattgcgatgtatgagtggctgcccagcttcctg
aagcaaactcctccggagtatccaggataccgtccatttctggaccccagtatctcccca
gagttcgttgtggcctctgagcagttcctctctaccatggtgccctctggggtctacatg
aggaatgccagttgtcatttccaggggattcccagtcataactcaagtgtctctggagct
ctccgggtctgcaacagctactggagtcgagagcaccccaagctacaaagggctgaagat
gtggatgcactgctgctgggcatggcctcccagattgctgagagagaggaccacgtggtg
gttgaggacatgcaagatttctggcctgggccactgaagttttcccgtacagactacctg
gccagctgcctgcagaggggccgggatctaggcctgccttcttacaccaaagccagggag
gcactgggcctgtctcccatttcccactggcaggacatcaaccctgcactctccaggagc
aatggcactgtgctggaggccacagctgccctgtacaatcaggacctgtctcggctggag
ctactcccaggggggcttctggagagccatggagaccctggaccccttttcagcactatt
gtccttgaccagtttgtcaggctacgagatggtgaccgttactggtttgaaaacaccagg
aacggattgttctctaaggaagagatcgcagagatccgaaacacttccctacgggacatt
ctagtggctgtcaccaatgtggaccccagtgccctacagcccaatgtcttcttttggctt
gcaggagacccctgtccacagccaagtcagctcagcgccaagggcctgccagcctgtgcc
cccctcttcattcgggactatttcgaggggagtggatttggcttcggactcaccattggg
accctttgctgtttccccttagtcagcctccttagtgcctggattgttgcccggcttcga
aagaggaatttcaagaggctccagagacaagaccgccagagcatcatgtcggagaagctt
gtagggggagtggaagctttggagtggcagggccgcaatgaaccctgcaggccagtgctt
gtgcacttacagccgggacagattcgagtagtggatggcaggctcaccgtgctccggacc
atccagctgcgacccccacagcaggtcaacctcatcctgtccagcaaccgtggacgccgc
accctgctgctcaagatccccaaggagtatgacctggttctgttgtttaacatggaggag
gaacggcaggcactggtggaaaacgtcaggggagctctgaaggaaaatgggctgagcttc
caggagtgggaactgagggagcaggagctgatgagggcagcagtgaccaggcaacaacgg
ggccacctcctggagaccttcttcaggcaccttttctcccaggtgttagacatcaatcag
gctgatgcagggactctgcctctggattcctcgaccaaagtgcgtgaggccctgacctgt
gagctgagcagagctgagtttgcagactccctaggcctcaagccccaggacatgtttgtg
gagtccatgttttctctagccgacaaggatggcaatggctacctgtccttccgggagttc
ctggacatcctggtggtcttcatgaaaggctccccagaggagaagtctcgtcttatgttc
cgaatgtatgactttgatgggaacggtctcatttccaaggatgagttcattaggatgcta
aggtccttcatcgagatctccaacaactgcctgtccaaggcccagctggctgaggtggtt
gagtctatgttccgggagtctggcttccaggacaaggaggagctgacctgggaggacttc
cacttcatgctgcgggaccacgacagtgatctccgattcacacagctctgtgtcaaaggt
gtggaagtgccggaagtgatcaagaacctctgccggcgagcctcctacatcagccaggag
aagatctgcccttcgcccagaatgagcgcccactgtgcccgaaacaacatgaagactgcg
tcatcaccacagagactgcagtgccccatggacacagaccctcctcaagagattcgacgg
aggtttggcaaaaaggtaacttcattccagcccttactgttcactgaggcacaccgagag
aagtttcaacgcagccgccgccaccaaacggtgcagcagttcaagcgctttattgagaat
tacaggcgccacattggctgtgtggcggtgttttacaccatcactggggcgctcttcctg
gagagagcctactactatgcatttgcagcacaccacagcggcatcaccgataccacccgt
gtaggcatcatcctgtcccggggcacggcggccagcatctcctttatgttttcctacatc
ctgctcaccatgtgtcgcaacctcatcaccttcttgcgggagaccttcctcaaccgctac
attcccttcgatgctgccgtggacttccatcgcctcatcgcctccacggccatcatcctc
acagtcttacacagtgctggccacgtagtgaatgtgtacctgttctccatcagtccactc
agtgtcctctcttgcctcttccctggcctcttccacgatgatgggtcggagttccctcag
aagtattactggtggttcttccagactgtgccaggtctcactggggtcctcctgctcctg
gccctggccatcatgtacgtcttcgcctcccaccacttccgccgccgcagtttccggggc
ttctggctgacccatcacctctacatttttctctacattctgctcatcatacatggcagc
tttgctctgatccagatgccccggttccacatcttcttcctggtccctgcaattatttat
gtgggggacaagctggtgagcctgagccggaagaaggtggagatcagcgtggtgaaggct
gagctgctgccatcaggagtgacccacctgcggttccagaggcctcagggctttgagtat
aagtcagggcagtgggttcggattgcgtgcctggctctgggaaccaccgagtatcaccct
ttcacactgacttctgcaccccacgaggacacactcagcctgcacatccgggcggctgga
ccctggaccactcgcctcagggaaatctactcacccccaacgggtgacacctgtgccaga
tacccaaagctgtacctcgatggaccgtttggagagggccaccaggagtggcacaagttt
gaggtgtcagtgctggtaggagggggcattggagtcactccctttgcctccatcctcaaa
gacctggttttcaagtcatcagtcagctgccaagtgttctgtaagaagatctacttcatc
tgggtgacaaggactcagaggcagtttgagtggctggctgacatcatccgggaggtggag
gagaatgaccgccaggacctggtgtctgtgcacatctatattactcagctggctgagaag
ttcgacctcaggaccaccatgctgtacatctgtgagcggcacttccagaaggtgctgaac
aggagtctgttcacgggcctgcgctccatcacccactttggtcgccctccctttgagccc
tttttcaactctctgcaggaagtccacccccaagtccgaaagattggagtatttagctgt
ggtccccctggcatgaccaagaatgtggagaaggcttgtcagctcatcaacaggcaggac
aggactcatttttctcaccattatgagaacttctag

DBGET integrated database retrieval system