KEGG   Mus musculus (house mouse): 99633
Entry
99633             CDS       T01002                                 
Symbol
Adgrl2, AI450192, CIRL-2, Gm619, Lec1, Lphh1, Lphn2, mKIAA0786
Name
(RefSeq) adhesion G protein-coupled receptor L2
  KO
K04593  adhesion G protein-coupled receptor L2
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    99633 (Adgrl2)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    99633 (Adgrl2)
Peptidases and inhibitors [BR:mmu01002]
 Mixed peptidases
  Family P2
   99633 (Adgrl2)
G protein-coupled receptors [BR:mmu04030]
 Adhesion receptor family
  Latrophilin
   99633 (Adgrl2)
SSDB
Motif
Pfam: Latrophilin OLF 7tm_2 GAIN Gal_Lectin GPS HRM
Other DBs
NCBI-GeneID: 99633
NCBI-ProteinID: NP_001074767
MGI: 2139714
Ensembl: ENSMUSG00000028184
UniProt: A0A0G2JGM8
Position
3:complement(148521222..148695808)
AA seq 1487 aa
MVSSGCRMRSLWFIIIISFSPSTEGFSRAALPFGLVRRELSCEGYSIDLRCPGSDVIMIE
SANYGRTDDKICDADPFQMENTDCYLPDAFKIMTQRCNNRTQCIVVTGSDVFPDPCPGTY
KYLEVQYECVPYMEQKVFVCPGTLKAIVDSPCIYEAEQKSGAWCKDPLQAADKIYFMPWT
PYRTDTLIEYASLEDFQNSRQTTTYKLPNRVDGTGFVVYDGAVFFNKERTRNIVKFDLRT
RIKSGEAIINYANYHDTSPYRWGGKTDIDLAVDENGLWVIYATEQNNGMIVISQLNPYTL
RFEATWETAYDKRAASNAFMICGVLYVVRSVYQDNESEAGKNTIDYIYNTRLSRGEYVDV
PFPNQYQYIAAVDYNPRDNQLYVWNNNFILRYSLEFGPPDPAQVPTTAVTITSSAELFKT
TISTTSSASQRGPVSSTAAGPQDGSRGTKPPPAVSTTKIPPVTNIFPLPERFCEALDWKG
IKWPQTQRGMMVERPCPKGTRGTASYLCMASTGTWNPKGPDLSNCTSHWVNQLAQKIRSG
ENAASLANELAKHTKGHVFAGDVSSSVRLMEQLVDILDAQLQELKPSEKDSAGRSYNKLQ
KREKTCRAYLKAIVDTVDNLLRAEALESWKHMNSSEQAHTATMLLDTLEEGAFVLADNLL
EPTRVSMPTENIVLEVAVLSTEGQVQDFKFPLGLKGLGSSIQLSANTVKQNSRNGLAKLV
FIIYRSLGQFLSTENATIKLGADLMGRNSTIAVNSPVISVSINKESSRVYLTDPVLFTLP
HIDPDNYFNANCSFWNYSERTMMGYWSTQGCKLVDTNKTRTTCACSHLTNFAILMAHREI
AYKDGVHHLLLTVITWVGIVVSLVCLAICIFTFCFFRGLQSDRNTIHKNLCINLFIAEFI
FLIGIDKTKYTIACPVFAGLLHFFFLAAFSWMCLEGVQLYLMLVEVFESEYSRKKYYYVA
GYLFPATVVGVSAAIDYKSYGTVQACWLHVDNYFIWSFIGPVTFIILLNIIFLVITLCKM
VKHSNTLKPDSSRLENINNYRVCDGYYNTDLPGYEDNKPFIKSWVLGAFALLCLLGLTWS
FGLLFVNEETVVMAYLFTAFNAFQGLFIFIFHCALQKKVRKEYGKCFRHWYCCGGLPTES
PHSSVKASTTRTSARYSSGTQSRIRRMWNDTVRKQSESSFISGDINSTSTLNQGMTGNYL
LTNPLLRPHGTNNPYNTLLAETVVCNAPSAPAFNSPGHSLNNARDTSAMDTLPLNGNFNN
SYSLRKADYHDGVQVVDCGLSLNDTAFEKMIISELVHNNLRGGNKTHNLELKLPVKPVIG
GSSSEDDAIVADASSLMHGDNPGLEFRHKELEAPLIPQRTHSLLYQPQKKVKPEATDSYV
SQLTAEADDHLQSPNRDSLYTSMPNLRDSPYPESSPDMAEDLSPSRRSENEDIYYKSMPN
LGAGRHLHMCYQISRGNSDGYIIPINKEGCIPEGDVREGQMQLVTSL
NT seq 4464 nt   +upstreamnt  +downstreamnt
atggtgtcttctggctgcagaatgcgaagtctgtggtttatcattataatcagtttctca
ccgagtacagaaggtttcagcagagcagccttaccattcgggttagttagacgagagcta
tcctgtgagggttattctatagacctgcgatgtccgggcagtgacgtcatcatgatcgag
agtgcgaactacggtcggacggacgacaagatctgcgatgcagacccctttcaaatggag
aacacagactgctacctccctgatgccttcaaaatcatgactcaaaggtgcaacaatcga
acacagtgtatagtagttaccgggtcagatgtatttcctgatccatgtcccggaacttac
aaataccttgaagttcaatatgaatgtgtcccttacatggagcaaaaagtctttgtgtgt
cctggaaccttgaaagcaattgtggactcaccatgtatatatgaagctgagcagaagtca
ggggcttggtgcaaggacccccttcaggctgcagataaaatttattttatgccctggact
ccctaccgcaccgatacgttaatagaatatgcctctttagaagattttcaaaacagccgc
cagacaacaacatacaaacttccaaaccgagtagacggtactggatttgtggtgtatgat
ggagccgtcttctttaacaaggaaagaaccagaaacattgttaagtttgacttgaggact
agaatcaagagcggcgaggctatcatcaactatgccaactaccacgatacgtcaccctac
agatggggtgggaagacagacattgacctcgcagtggatgagaacggcttatgggtcatt
tatgccacggagcagaacaatggaatgatcgtgatcagccagctcaacccttacactctt
cgattcgaggcaacctgggagacagcgtatgacaagcgtgcggcgtccaatgctttcatg
atatgtggggttctctatgtggtcaggtcagtgtaccaagacaatgaaagcgaagcaggc
aagaacaccattgactacatctacaacacgcgactaagccggggcgagtacgtggacgtt
ccttttcccaaccagtaccagtatattgctgcagtggattataatccaagagacaaccaa
ctctacgtatggaacaataacttcattttacggtattccctggagtttggtcctcctgac
cctgcccaagtgcctaccacagctgtgacaataacttcttcagctgagctgttcaaaacc
acaatatccaccacgagcagtgcctcccagcgaggccccgtgagcagcactgcagctggt
cctcaggacggaagcagagggacaaagccacctccagccgtctctacaaccaaaattcct
cctgtaacaaatatttttcccctgccagagagattctgcgaagcgttagactggaagggg
ataaagtggcctcagacacaaagggggatgatggttgagcgaccctgtcccaagggaaca
agagggacggcctcgtatctgtgcatggcttccacgggaacatggaacccgaagggccct
gatcttagcaactgcacgtctcactgggtgaaccagctggcccagaagatcagaagtgga
gagaatgctgcgagcctggccaatgaactagctaagcacaccaaggggcatgtgtttgca
ggggacgtgagctcctctgtgaggctgatggaacagttggtggacatcctggatgctcag
ctgcaggagctgaagccgagtgagaaggattcggctgggaggagctataacaagctccaa
aaacgagagaagacatgcagggcttaccttaaggcaattgtggacacggtagacaacctt
ctgagagctgaggctttggaatcctggaaacacatgaattcttcagagcaggcgcacaca
gccacaatgttgttggataccttggaagaaggagcattcgtcctagcagacaaccttttg
gaaccaaccagggtctccatgccaacagaaaatattgttttagaagttgctgtcctcagc
acggaagggcaggtccaagactttaaattccctctgggcttaaaggggttgggcagctcc
atccagctctctgccaacacggtcaaacagaacagcaggaatgggctggccaagctggta
ttcatcatttaccggagcctgggacaattcctaagcactgagaacgcaaccataaagctg
ggtgcagacctcatgggtcggaacagcaccattgcggtgaactctcccgtcatctccgtc
tccatcaataaggagtccagccgcgtgtacctgacagatcccgtgcttttcacactgcca
cacattgatcctgacaattatttcaatgcaaactgctccttctggaactactcagagaga
accatgatgggatattggtctacccagggctgcaagctggttgacactaataaaactcgc
acaacgtgcgcttgcagccacctaaccaattttgctattctcatggcccacagggaaatt
gcgtataaagatggagtgcaccacctgttgctgacagtcatcacctgggtgggcatcgtt
gtctccctcgtctgcctggctatctgcatcttcaccttctgtttcttccgagggctacaa
agtgaccgcaatactatccacaagaacctttgtatcaaccttttcattgctgaatttatt
tttctcatcggcatcgataagacaaaatacacgattgcatgccccgtgttcgcagggctt
cttcactttttcttcctggctgctttttcctggatgtgcctggaaggtgtgcagctctac
ctaatgttggttgaggttttcgagagcgaatattcaaggaagaaatattactatgtcgct
gggtacctgttcccggccacagtggtcggcgtctcagcagccattgactacaagagttac
gggacagtccaggcttgctggcttcacgttgataactatttcatatggagtttcatcggg
cctgttactttcattattctgctaaatattattttcctggtgatcacgctgtgcaaaatg
gtgaaacattcaaacactctgaaaccagattctagcaggttggaaaacattaataattac
cgtgtttgtgatggctactataatacggacttacctggctatgaagataataagccattt
atcaagtcttgggtacttggcgcgttcgccctgctgtgtctcctgggcctcacctggtcc
tttgggttgctttttgttaacgaggagactgttgtcatggcgtatctcttcaccgccttt
aatgctttccagggactcttcattttcatcttccactgtgctcttcaaaagaaagtacga
aaagagtatggcaagtgcttcagacactggtactgctgtggcggcctcccgaccgagagc
ccgcacagctctgtgaaggcatccaccacccgcaccagtgctcggtactcctctggcaca
cagagccgtataagaaggatgtggaatgacaccgtgaggaagcagtctgaatcgtctttt
atctcaggtgacatcaatagcacttctacccttaaccaagggatgactggcaattaccta
ctaacaaaccctcttctccggccccacggcactaacaacccctataacaccctgctcgct
gaaacagttgtatgcaatgccccttcagctcctgcgtttaactcgccaggacattcactg
aacaatgcccgggacacaagtgccatggatactctaccgctaaatggtaacttcaacaac
agctattccctgcgcaaggcggactaccacgacggcgtgcaggtcgtggactgtggacta
agtctgaacgacaccgcgtttgagaaaatgatcatttcagagttagtgcacaacaacctc
cggggcggcaacaaaacccacaacttggagctcaagctcccggttaaaccggtgattggc
ggcagcagcagtgaagatgacgcgattgtggctgacgcctcatctttgatgcatggtgac
aacccagggctggagttccgccacaaagagctggaggcgccgctcatcccccagcggact
cactcgcttctgtaccaaccccagaaaaaagtgaagccggaggcaacagacagctacgtc
tcccagctgacggccgaggccgacgaccacctccagtcccccaacagagactctctgtac
acgagcatgcccaacctaagagactctccctacccggagagcagcccagacatggcagag
gacctgtctccctccaggaggagtgagaacgaggacatttactataaaagtatgcccaac
cttggagctggccgccatctccacatgtgctaccagatcagcaggggcaatagcgatggt
tacatcatccccattaacaaagaagggtgcatccctgagggggacgtccgggaaggacag
atgcagctggtgacaagtctttaa

DBGET integrated database retrieval system