KEGG   Mus musculus (mouse): 99738
Entry
99738             CDS       T01002                                 

Gene name
Kcnc4, AI850292, KSHIIIC, Kcr2-, Kcr2-4, Kv3., Kv3.4
Definition
(RefSeq) potassium voltage gated channel, Shaw-related subfamily, member 4
  KO
K04890  potassium voltage-gated channel Shaw-related subfamily C member 4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    99738 (Kcnc4)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   99738 (Kcnc4)
SSDB
Motif
Pfam: Ion_trans BTB_2 Potassium_chann Ion_trans_2 BTB_3
Other DBs
NCBI-GeneID: 99738
NCBI-ProteinID: NP_666034
MGI: 96670
Ensembl: ENSMUSG00000027895
Vega: OTTMUSG00000052959
UniProt: Q8R1C0
Position
3 F2.3; 3 46.83 cM
AA seq 628 aa
MISSVCVSSYRGRKSGNKPPSKTCLKEEMAKGEASEKIIINVGGTRHETYRSTLRTLPGT
RLAWLADPDGGGRPESDGGGAGSSGSSGGGGGGGGCEFFFDRHPGVFAYVLNYYRTGKLH
CPADVCGPLFEEELTFWGIDETDVEPCCWMTYRQHRDAEEALDIFESPDGGGGGAGPGDE
AGDDERELALQRLGPHEGGSGPGAGSGGCRGWQPRMWALFEDPYSSRAARVVAFASLFFI
LVSITTFCLETHEAFNIDRNVTEIHRVGNITSVRFRREVETEPILTYIEGVCVMWFTLEF
LVRIVCCPDTLDFVKNLLNIIDFVAILPFYLEVGLSGLSSKAARDVLGFLRVVRFVRILR
IFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGARPSDPRGND
HTDFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFG
MYYSLAMAKQKLPKKRKKHVPRPPQLESPIYCKSEETSPRDSTYSDTSPPAREEGVVERK
RADSKQNGDANAVLSDEEGAGLTQPLALAPTPEERRALRRSGTRDRNKKAAACFLLSAGD
YACADGSVRKEGNVEPKACVPVSHTCAL
NT seq 1887 nt   +upstreamnt  +downstreamnt
atgatcagctcggtgtgtgtctcctcctaccgcgggcgcaagtcggggaacaagcctccg
tccaaaacatgtctgaaggaggagatggccaagggcgaggcgtcggagaagatcatcatc
aacgtgggcggcacgcgacatgagacctaccgcagcaccctgcgcaccctaccgggcacc
cgccttgcctggttggcggatcccgacggcgggggtcggccagagtcggatggcggcggt
gcaggcagcagcggcagcagcggcggcggcggcggcggcgggggctgtgagttcttcttt
gatcggcacccgggtgtttttgcctatgtgctcaactactaccgtacgggcaagctgcat
tgccccgcagacgtctgtgggcctctctttgaggaagagctcaccttctggggtatcgat
gaaacagatgtggaaccctgctgctggatgacctaccggcagcaccgcgatgctgaggag
gcactggacatcttcgagagcccggacgggggcgggggtggcgcagggccaggcgacgag
gctggcgacgatgagcgggagttggccttgcagcgcctgggcccccatgaaggaggctct
ggccctggtgctgggtccggagggtgccgtggctggcagccccgaatgtgggcgctcttc
gaggatccctactcatcccgggcggccagggtggtagcctttgcctctctcttcttcatc
ttggtctccattaccaccttctgcctggagacccatgaggccttcaacattgaccgaaac
gtgacggagattcatcgggtagggaatatcaccagcgtgcgcttccggcgggaggtagaa
acagagcccattcttacctacatcgagggtgtgtgcgtgatgtggttcactctagagttc
ctggttcgcattgtgtgctgccctgatacgctggactttgtcaagaacttgctcaacatc
atcgactttgtggccatcttacccttttacctggaggtgggattgagtggtttgtcttcc
aaggcagctcgcgatgtgctgggtttcctgcgtgtggtacgctttgtacgcatcctgcgg
atcttcaagctcacacgccactttgtggggctgcgtgtgctaggccacactctccgggcc
agcactaatgagttcctgttgcttatcatcttcttggccctgggtgtgctcatcttcgcc
accatgatctattatgccgagcgaattggggccaggccatctgacccacggggcaacgac
cacaccgacttcaagaacatccccatcggtttctggtgggctgtggtcaccatgacaacg
cttggctatggggacatgtatcccaagacgtggtcaggaatgttggtgggtgcgctgtgt
gcgctggctggtgtgctgaccattgccatgcccgtgcctgtcatcgtcaataactttggt
atgtactactccctggctatggccaagcagaagctgcccaagaagcgaaagaagcacgta
ccacggccaccccagctcgaatcgcccatttactgcaagtctgaggagacttcaccccgg
gacagcacctacagtgacaccagcccccctgcccgggaagagggtgtggtcgagaggaaa
cgggccgactctaagcagaatggcgatgctaatgcggtgctgtctgatgaggagggagct
ggcctcactcagcccttggccttggcccccacccctgaagagcgtcgggccctgagacgc
tcaggcacgcgggacagaaacaagaaggcagctgcctgcttcctgctcagtgctggggac
tatgcctgtgctgatggcagtgtccggaaagaaggcaatgttgagccgaaagcgtgcgtc
ccagtgtctcacacctgtgctctttaa

DBGET integrated database retrieval system