KEGG   Mus musculus (mouse): 99982
Entry
99982             CDS       T01002                                 

Gene name
Kdm1a, 1810043O07Rik, AA408884, Aof2, D4Ertd478e, Kdm1, Lsd1, mKIAA0601
Definition
(RefSeq) lysine (K)-specific demethylase 1A
  KO
K11450  [histone H3]-N6,N6-dimethyl-L-lysine4 FAD-dependent demethylase [EC:1.14.99.66]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    99982 (Kdm1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    99982 (Kdm1a)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.66  [histone H3]-N6,N6-dimethyl-L-lysine4 FAD-dependent demethylase
     99982 (Kdm1a)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    99982 (Kdm1a)
SSDB
Motif
Pfam: Amino_oxidase SWIRM NAD_binding_8 DAO Pyr_redox_2 AlaDh_PNT_C Pyr_redox FAD_binding_2 FAD_oxidored HI0933_like FAD_binding_3 Thi4 GIDA 2-Hacid_dh_C MutS_IV Lycopene_cycl Pyr_redox_3 DUF1917
Other DBs
NCBI-GeneID: 99982
NCBI-ProteinID: NP_598633
MGI: 1196256
Ensembl: ENSMUSG00000036940
Vega: OTTMUSG00000009707
UniProt: Q6ZQ88
Position
4 D3; 4 68.8 cM
AA seq 853 aa
MLSGKKAAAAAAAAAAAAAAGTEAGSGAAGGAENGSEVAAPPAGLTGPTDMATGAAGERT
PRKKEPPRASPPGGLAEPPGSAGPQAGPTAGPGSATPMETGIAETPEGRRTSRRKRAKVE
YREMDESLANLSEDEYYSEEERNAKAEKEKKLPPPPPQAPPEEENESEPEEPSGVEGAAF
QSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLE
APYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPIKKTGKVIIIGSGVSGLAAARQLQS
FGMDVTLLEARDRVGGRVATFRKGNYVADLGAMVVTGLGGNPMAVVSKQVNMELAKIKQK
CPLYEANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQALEVVIQLQ
EKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEASEVKPPRDITAEFL
VKSKHRDLTALCKEYDELAETQGKLEEKLQELEANPPSDVYLSSRDRQILDWHFANLEFA
NATPLSTLSLKHWDQDDDFEFTGSHLTVRNGYSCVPVALAEGLDIKLNTAVRQVRYTASG
CEVIAVNTRSTSQTFIYKCDAVLCTLPLGVLKQQPPAVQFVPPLPEWKTSAVQRMGFGNL
NKVVLCFDRVFWDPSVNLFGHVGSTTASRGELFLFWNLYKAPILLALVAGEAAGIMENIS
DDVIVGRCLAILKGIFGSSAVPQPKETVVSRWRADPWARGSYSYVAAGSSGNDYDLMAQP
ITPGPSIPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIADQFLGAMYTLPRQ
ATPGVPAQQSPSM
NT seq 2562 nt   +upstreamnt  +downstreamnt
atgttgtctgggaagaaggcggcggcggcggcagcggcagcggcggcggcggcggctgct
gggaccgaggccgggtccggggcggcgggcggtgccgagaacggctctgaggtggccgcg
ccgcccgcgggcctgacgggccccaccgacatggctacgggggcggcgggcgagcgcact
ccccgaaagaaggagcctccgcgggcctcgccgcccgggggcctagccgagccgccgggg
tctgctgggccccaggcggggcccacagccgggcccggctccgcgacgcccatggagacc
ggaatagccgagaccccggagggccgacggaccagccggcgcaagcgggccaaggtagaa
tacagagaaatggatgaaagcttggccaacctctcagaagatgaatattattcggaagaa
gaaagaaatgctaaagcagagaaggaaaagaagcttcccccaccacctcctcaagcccca
cctgaggaagaaaatgaaagtgagccggaagagccgtctggtgtggagggtgcagctttt
caaagccgacttccccatgaccgaatgacctctcaggaagcagcctgtttcccagacatc
atcagtgggcctcagcagacacagaaggtttttctgttcatcaggaatcgcacattgcag
ttatggctggacaacccaaagatccagctgacgtttgaagccactctccagcagctggaa
gcgccttacaacagcgatactgtgcttgtccaccgagttcacagttacttagagcgccat
ggtcttatcaacttcggcatctacaagaggataaaacccttaccaattaaaaagacagga
aaggtgattattataggttcaggtgtttctggcttggcagcagctcgacagctacagagt
tttgggatggatgtcacacttctggaagccagggatcgagtaggtggacgagttgctaca
tttcgaaaaggaaactatgtagctgatcttggcgccatggttgtaacaggtcttggaggg
aatcccatggctgtcgtcagcaaacaagtaaatatggaactggccaagatcaagcaaaaa
tgcccactttatgaagccaatggacaagctgttccaaaagaaaaagatgaaatggtagaa
caagaatttaaccggttgctagaagccacttcttaccttagtcaccagttagacttcaac
gtcctcaataataaacctgtatcccttggccaggcattggaggttgtcattcagctgcaa
gaaaagcatgtcaaagatgagcagattgaacattggaagaagatagtgaaaactcaggag
gagttgaaagagcttcttaataagatggtaaatttgaaggagaaaattaaagagctccat
cagcaatacaaagaagcttcagaagtgaagccgcccagagatatcacagccgagttcctg
gtgaagagcaagcacagggacctgactgccctctgcaaggaatatgatgaattagctgaa
acacaaggaaagctagaagaaaaacttcaagaattggaagccaatcccccaagtgatgta
tacctctcatcaagagacagacaaatacttgactggcattttgcaaatcttgaatttgcc
aacgccacacctctctctaccctctctcttaaacattgggatcaggatgatgactttgag
tttactggaagccacctgacagtaaggaatggctactcatgtgtgcctgtggctttagct
gaaggcttggacattaaactgaacacagcagtgcggcaggttcgctacacagcctcagga
tgtgaagtgattgctgtgaacacacgttccacaagtcaaacctttatttataagtgtgat
gcagttctctgtacacttcctttgggagtgttgaagcagcagccaccagctgttcagttt
gtgccacctcttcctgagtggaaaacatctgcagtccaaaggatgggatttggcaacctt
aacaaggtggtgttatgctttgaccgtgtgttctgggacccaagtgtcaatttgtttggg
cacgttggcagtacaactgctagcaggggtgagctcttcctcttctggaacctatataaa
gctccaatactattggccctggtagcaggagaagctgctggcattatggagaacattagt
gatgatgtgattgtcggccggtgcctggccattctcaaagggatttttggcagcagtgca
gtcccacagcccaaggaaactgtggtatctcgttggcgtgctgatccgtgggcccggggc
tcctattcttatgtggctgcaggatcctctggaaatgactatgatttaatggctcagccg
atcactcctggcccctcaattccaggtgccccacagccaatcccaagactcttctttgct
ggagaacacacaatccggaactacccagctacagtccatggtgctctgttgagtgggctt
cgagaagcaggaaggattgccgaccagtttttgggagccatgtacactttgcctcgtcag
gccacaccaggtgtccctgcacagcagtccccaagtatgtga

DBGET integrated database retrieval system