KEGG   Mus musculus (mouse): 11799Help
Entry
11799             CDS       T01002                                 

Gene name
Birc5, AAC-11, Api4, TIAP, survivin40
Definition
(RefSeq) baculoviral IAP repeat-containing 5
  KO
K08731  baculoviral IAP repeat-containing protein 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01524  Platinum drug resistance
mmu04210  Apoptosis
mmu04215  Apoptosis - multiple species
mmu04390  Hippo signaling pathway
mmu05161  Hepatitis B
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    11799 (Birc5)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    11799 (Birc5)
   04215 Apoptosis - multiple species
    11799 (Birc5)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    11799 (Birc5)
   05210 Colorectal cancer
    11799 (Birc5)
  09167 Infectious diseases
   05161 Hepatitis B
    11799 (Birc5)
  09168 Drug resistance
   01524 Platinum drug resistance
    11799 (Birc5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    11799 (Birc5)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     11799 (Birc5)
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    11799 (Birc5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BIR
Motif
Other DBs
NCBI-GeneID: 11799
NCBI-ProteinID: NP_033819
MGI: 1203517
Ensembl: ENSMUSG00000017716
Vega: OTTMUSG00000003737
UniProt: O70201 Q549P2
Structure
PDB: 

Position
11; 11 E2
AA seq 140 aa AA seqDB search
MGAPALPQIWQLYLKNYRIATFKNWPFLEDCACTPERMAEAGFIHCPTENEPDLAQCFFC
FKELEGWEPDDNPIEEHRKHSPGCAFLTVKKQMEELTVSEFLKLDRQRAKNKIAKETNNK
QKEFEETAKTTRQSIEQLAA
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgggagctccggcgctgccccagatctggcagctgtacctcaagaactaccgcatcgcc
accttcaagaactggcccttcctggaggactgcgcctgcaccccagagcgaatggcggag
gctggcttcatccactgccctaccgagaacgagcctgatttggcccagtgttttttctgc
tttaaggaattggaaggctgggaacccgatgacaacccgatagaggagcatagaaagcac
tcccctggctgcgccttcctcactgtcaagaagcagatggaagaactaaccgtcagtgaa
ttcttgaaactggacagacagagagccaagaacaaaattgcaaaggagaccaacaacaag
caaaaagagtttgaagagactgcaaagactacccgtcagtcaattgagcagctggctgcc
taa

DBGET integrated database retrieval system