KEGG   Mus musculus (mouse): 71355Help
Entry
71355             CDS       T01002                                 

Gene name
Col24a1, 5430404K19Rik
Definition
(RefSeq) collagen, type XXIV, alpha 1
  KO
K19721  collagen, type V/XI/XXIV/XXVII, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    71355 (Col24a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    71355 (Col24a1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   71355 (Col24a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen COLFI Laminin_G_3 Laminin_G_2
Motif
Other DBs
NCBI-GeneID: 71355
NCBI-ProteinID: NP_082046
MGI: 1918605
Ensembl: ENSMUSG00000028197
Vega: OTTMUSG00000021259
UniProt: Q30D77
Position
3; 3 H2
AA seq 1733 aa AA seqDB search
MHLGAYRTRHGKVSPTTETKLFLRFIVLCVVWISVHAQGQGIDILQQLGLGGRDVRYTSS
VTAVPSSSWSTPLPQGVHLTDFGVILTDNAYIESPLVNILPISLRQPLTVLIGLQSFKVN
NAFLFSIRNNNRLQFGVQLLPKKLIVHVGGKQTVTFNYSAHDERWHSFAITVDHHVISMF
VECGKRHFSGETTSDVQTFDPHSVFTLGSINNSSAHFEGTVCQLEIMPSTAASAEYCRHL
KQQCLRADASQAQRNLPHTAGMPTRHPAHTPLPRGFPGTDSPQKRFTEQDSLPKGFDGTE
LPRETFADGKSIPNNRSNGSATVHESQEHQTPRAQLTSFHSGNISAVTLPNYRIQAKEIT
TKEETNLTLSVAHHLPSEARMNEEGRINPLFAGFDNITQHEEAAGLPLPKKASSGFAHTN
QDTMKNLEKALTANLYTNELIEMERILNSTLYRVMYGPSVDNHLELRKEGEFYPDATNPI
EGSYEPQAYDYYSYEDYNAVLDMEYLRGPKGDPGPPGPPGPMGIPGPSGKRGPRGIPGPH
GNPGLPGLPGPKGPKGDPGLSPGQAASGEKGDPGLLGLVGPPGLQGAKGLKGHPGLPGLR
GEHGLPGLAGNIGSPGYPGRQGLAGPEGNPGSKGVRGFIGSPGEVGQLGPEGERGTPGVR
GKKGPKGRQGFPGDFGDRGPAGLDGSPGLVGGTGPPGFPGVTGSVGPAGPTGPPGAPGPM
GLSGSRGPSGIKGDKGEQGVAGEPGEPGYPGDKGNIGSPGPPGIRGKSGPSGQPGDPGPQ
GPSGPPGPEGFPGDIGIPGQNGPEGPKGHLGNRGPPGPPGLKGTQGEEGPIGPFGELGSR
GKPGRKGYMGEPGPEGLKGEVGDQGDIGKTGETGPVGLPGEVGITGSIGEKGERGSPGPL
GPQGEKGVMGYPGPPGAPGPMGPLGLPGLVGARGAPGSPGPKGQRGPRGPDGLAGDQGGH
GAKGEKGNQGKRGLPGLPGKAGSPGERGVQGKPGFQGLPGSSGDVGPAGEPGPRGLPGIA
GLPGEMGVEGPPGTEGDSGLQGEPGAKGDGGPAGSAGATGEPGPRGEPGAPGEEGLQGKD
GLKGAPGGSGLPGEDGDKGEMGLPGTAGPVGRPGQMGLPGPEGIVGTPGQRGRLGKKGDK
GQVGPTGEAGSRGPPGSVGENGPKGARGTRGAVGPLGLMGPEGEPGIPGYRGHQGQPGPS
GLPGPKGEKGYPGEDSTVLGPPGPPGEPGPMGEQGETGEHGEEGYKGHMGVPGLRGATGQ
QGPPGEPGDQGGQGPKGERGSEGPQGKRGVPGPSGKPGIPGVPGFPGPKGLQGYPGVDGM
SGYPGKPGLPGKQGLLGVPGSPGRTGVAGSPGPQGGKGASGPPGSPGAPGPKGEQGLPGQ
PGVPGQRGHRGTPGDQGLRGAPGLKGQPGEHGDQGLAGFQGFPGPRGPEGDAGIVGIVGP
KGPIGQRGNTGPLGREGIIGPTGGTGPRGEKGFRGETGPQGPRGQPGPPGPPGAPGPRRQ
MDINAAIRALIESNSAQQMESYQNTEGTLISHSSDIFKTLTYLSSLLSSIKNPLGTRENP
ARICKDLLSCQYKVSDGKYWIDPNLGCSSDAFEVFCNFSAGGQTCLSPVSVTKLEFGVSK
VQMNFLHLLSSEATHTITIHCLNTPRWSSTWADGPELPISFKGWNGQIFEENTLLEPQVL
SDDCKIQDGSWHKAKFLFHTQNPNQLPVTEVQNLPHLGTEQKRYIESNSVCFL
NT seq 5202 nt NT seq  +upstreamnt  +downstreamnt
atgcatttaggagcctacaggacaaggcatggaaaggtctcccccaccacagaaacgaaa
ctgtttcttcgctttattgtactatgtgtggtgtggatttctgttcatgcacagggacaa
ggcatagatattcttcagcaactaggccttggaggcagagatgtaagatacacgtcatcg
gtgacagctgtgccgtcatcgtcatggtccacaccattacctcagggggtccatttaaca
gactttggtgtcatcttaacagataatgcctatattgagtcacctctcgtgaacatttta
cccattagcctaagacagccactgacagtattgattgggttgcaatcattcaaagtgaac
aatgcatttctcttcagcattcggaataacaacagactgcagtttggcgtacagctacta
cctaagaaactaatagttcatgtcggaggaaagcagacagtaaccttcaactacagtgcc
catgatgagcgatggcactcattcgccatcactgttgaccaccatgtcatctccatgttt
gttgagtgtggaaagagacattttagtggagagacgacttcagacgttcagacctttgac
cctcacagtgtgtttaccttgggaagtataaataacagctctgcccactttgaaggaaca
gtgtgccagttggagatcatgccttccacagcggcatctgcggagtattgcagacacctg
aaacagcagtgcctcagagcagacgcatcccaagctcaaagaaaccttcctcacacggca
ggaatgcccaccagacaccctgcgcacactccattacccagaggatttcctggaacagat
tcaccacagaagagattcacagagcaggattccttgccaaaaggatttgatggaacagaa
ctgccacgggagacgttcgctgatggcaaaagcattccaaacaacagaagtaatggttct
gccacggtacatgaaagccaagagcaccagacaccaagggctcagttaacttctttccat
tcaggaaacatctccgctgtgactctcccaaactacagaattcaggctaaagaaatcacc
accaaggaagaaacaaatttaaccctgtcagtggcccatcacctccctagtgaggcaaga
atgaatgaagaggggagaattaaccctctcttcgctggattcgacaacatcacccaacac
gaggaggcagctggcctgcccctgcctaagaaagcatcatccggctttgcacacacaaat
caagacaccatgaagaacctcgagaaggctctcacggcaaatctatacaccaatgagctc
atagaaatggaacggatcttaaacagcaccttgtatagagttatgtacgggccctcggtg
gataaccaccttgaactaaggaaggaaggtgaattttaccctgatgccacgaatcccatc
gaaggcagctatgagccccaggcttatgattattactcttatgaggattacaacgcagtg
cttgacatggagtacctgagagggccgaagggagacccgggacctcctggtccccctggt
ccgatgggtatcccaggtccgtcaggcaagagaggcccgcggggtattccaggaccacat
ggaaatcccgggttgcctggactgccaggtccaaagggccccaaaggagatcctgggctg
tccccaggccaagctgcttctggagaaaagggtgacccaggtcttttggggttagtgggc
ccccctggcttacaaggtgcaaagggtctcaaaggacatccagggctccccggactccgc
ggcgaacacggacttccaggactcgctggtaatattggctcacctggctaccctggcagg
cagggtttagctggaccagagggtaacccaggctccaaaggtgtccgaggtttcatcggt
tctcctggagaggtgggacagctgggacctgaaggagaaaggggcacccctggggtccgt
ggaaagaagggtccgaaggggagacagggtttcccaggtgactttggagacagaggccct
gctggtctggatggcagtcctgggcttgtaggtggcaccggacctcccgggtttcctggt
gttacaggaagtgttggtcctgcaggaccgactggacctccaggagctcctggcccaatg
ggcctttcaggaagtagaggaccatctggaatcaaaggtgataagggtgagcaaggtgtg
gcaggggagccaggagaacccgggtatcctggagacaagggcaacattggatcaccagga
ccaccagggataagaggaaagtcaggaccttcaggacaaccaggtgacccaggaccacaa
ggaccatctggccctccaggaccagagggttttccgggagacattgggattcctggacaa
aatggacctgaaggaccaaagggacatcttggaaacagagggccccctggtcctccaggt
ctcaaaggaactcagggagaagaaggaccaattggaccctttggagaactgggatctagg
ggaaaaccaggtcgaaaagggtatatgggtgaaccagggccagaaggcttaaagggagaa
gtgggagaccaaggagatattgggaaaactggtgaaacagggcccgttggtttacctgga
gaagtagggataaccggaagcattggtgagaagggagaacgtggaagtccaggcccactt
ggtccccagggggaaaaaggtgtcatgggctacccaggtcctcctggggctccagggccc
atgggcccacttggattacctggtcttgttggggcaagaggcgcacctgggagtccgggt
cctaaaggacaaagaggacccagaggaccagatggccttgcaggggatcaaggaggacat
ggtgctaagggtgaaaaaggaaaccaagggaaaagagggcttcctggcctccccggtaag
gctggaagccctggggagaggggagttcaaggaaaaccgggcttccaaggactgcctggc
agctcaggagacgtggggcctgccggagaacccggaccacgaggactgcctggtattgct
ggacttcctggagagatgggtgttgagggacctcccggcactgagggagactctggcctg
caaggtgaaccaggtgctaagggagatggtggacctgccggcagtgctggagccactggg
gagccggggccgcgaggagaaccaggagcccctggagaagaaggtctccaaggaaaagat
gggttaaagggggctccaggaggaagcggacttcctggagaggatggagacaaaggagag
atgggcttaccaggaacggcagggcccgtggggagaccaggtcagatgggccttccagga
cctgaaggaattgtgggaaccccgggacaaagaggtcgactagggaaaaagggtgataaa
ggacaagtaggacccacgggagaagctggaagcagaggaccccctggaagcgttggggaa
aatggccctaagggtgccaggggaactcgaggtgctgtgggtccattaggattgatggga
cctgaaggcgaaccaggaatcccaggatacagaggtcatcaaggtcaaccaggaccctct
ggattgccaggacctaaaggagaaaagggctacccaggagaagatagcacagttctggga
cctcctgggcctccaggtgaaccagggccaatgggggagcaaggagagacaggggaacat
ggcgaagaaggctataagggccatatgggtgtgccaggactcaggggtgccactggacag
caaggacccccaggtgaaccaggtgaccagggtggacaaggaccgaaaggagagagagga
tctgaaggtcctcaggggaaaaggggagttcctggtccttctgggaagccaggcattccc
ggagttccaggctttcctgggccaaaaggcttacaaggataccctggagtcgacggcatg
tcaggataccctgggaagcctggtctaccaggaaaacaaggacttttgggtgtcccgggc
agcccagggagaacaggagtggctggatccccaggtcctcaaggaggaaaaggcgcatca
ggccctccaggaagccctggtgctccaggcccaaagggtgaacaagggctgcctggtcag
cctggagtcccgggtcaaagaggtcatcgaggaacaccaggcgaccaaggactccgtgga
gcgcctggtctgaaagggcagcctggggaacatggtgatcaaggtttggcaggtttccag
ggattcccaggccccagaggtcccgagggagatgctggcattgttggaattgtaggccct
aaaggtcccattgggcagagaggaaacactggccctcttggccgagaagggataataggc
ccaacgggtggaactggacccagaggtgaaaaaggctttagaggtgaaactggtccccaa
ggaccgagaggtcaaccaggaccccctggtccacctggagcacctggtccaagaagacaa
atggatatcaatgctgctattcgagctctgatagaatcaaattctgcccagcagatggag
agttaccagaacactgaagggaccttaatcagccacagttcagacatattcaaaaccctg
acctaccttagcagtctcctgagcagcatcaagaatcctcttggcacccgagaaaaccca
gcacggatctgcaaggatttgctcagctgtcagtacaaggtttcagatggaaaatactgg
attgacccaaatctcggatgctcttcagatgcctttgaggttttctgcaactttagtgct
ggaggccagacatgtttatctcccgtttctgtgacaaagttggagtttggagtcagcaaa
gtacagatgaactttcttcacttgctgagctcagaagccacccacaccatcaccattcac
tgtctaaacaccccaaggtggagcagcacatgggcggatggtccagagttgcctattagt
ttcaaaggatggaatggtcagatttttgaagaaaatactctacttgaaccacaagtcctc
tcagatgactgcaagattcaggatggtagctggcacaaggcgaaattcctttttcacacc
cagaatcctaatcagcttcctgtgactgaagtccaaaaccttcctcaccttggaactgag
caaaagcgctacattgaaagcaattccgtgtgctttctctaa

DBGET integrated database retrieval system