KEGG   Mus musculus (mouse): 14183Help
Entry
14183             CDS       T01002                                 

Gene name
Fgfr2, AU043015, AW556123, Bek, Fgfr-2, Fgfr-7, Fgfr7, KGFR, KGFRTr, svs
Definition
(RefSeq) fibroblast growth factor receptor 2
  KO
K05093  fibroblast growth factor receptor 2 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04144  Endocytosis
mmu04151  PI3K-Akt signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05215  Prostate cancer
mmu05226  Gastric cancer
mmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    14183 (Fgfr2)
   04015 Rap1 signaling pathway
    14183 (Fgfr2)
   04010 MAPK signaling pathway
    14183 (Fgfr2)
   04151 PI3K-Akt signaling pathway
    14183 (Fgfr2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    14183 (Fgfr2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    14183 (Fgfr2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    14183 (Fgfr2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    14183 (Fgfr2)
   05230 Central carbon metabolism in cancer
    14183 (Fgfr2)
  09162 Cancers: Specific types
   05226 Gastric cancer
    14183 (Fgfr2)
   05215 Prostate cancer
    14183 (Fgfr2)
  09176 Drug resistance: Antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    14183 (Fgfr2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    14183 (Fgfr2)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    14183 (Fgfr2)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    14183 (Fgfr2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     14183 (Fgfr2)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   14183 (Fgfr2)
CD molecules [BR:mmu04090]
 Proteins
  14183 (Fgfr2)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Growth factors/receptors
   14183 (Fgfr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase I-set Ig_3 Ig_2 ig V-set FGFR3_TM Ig_5 Ig_4 C2-set_2 Kinase-like
Motif
Other DBs
NCBI-GeneID: 14183
NCBI-ProteinID: NP_034337
MGI: 95523
Ensembl: ENSMUSG00000030849
Vega: OTTMUSG00000031222
UniProt: P21803 E9QK53
Structure
PDB: 

Position
7; 7 F3
AA seq 840 aa AA seqDB search
MGLPSTWRYGRGPGIGTVTMVSWGRFICLVLVTMATLSLARPSFSLVEDTTLEPEEPPTK
YQISQPEAYVVAPGESLELQCMLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPRD
SGLYACTAARTVDSETWYFMVNVTDAISSGDDEDDTDSSEDVVSENRSNQRAPYWTNTEK
MEKRLHAVPAANTVKFRCPAGGNPTPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESV
VPSDKGNYTCLVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVY
SDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYT
CLAGNSIGISFHSAWLTVLPAPVREKEITASPDYLEIAIYCIGVFLIACMVVTVIFCRMK
TTTKKPDFSSQPAVHKLTKRIPLRRQVTVSAESSSSMNSNTPLVRITTRLSSTADTPMLA
GVSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKD
DATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRP
PGMEYSYDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMK
IADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGG
SPYPGIPVEELFKLLKEGHRMDKPTNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIL
TLTTNEEYLDLTQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atgggattaccgtccacgtggagatatggaagaggaccagggattggcactgtgaccatg
gtcagctgggggcgcttcatctgcctggtcttggtcaccatggcaaccttgtccctggcc
cggccctccttcagtttagttgaggataccactttagaaccagaagagccaccaaccaaa
taccaaatctcccaaccagaagcgtacgtggttgcccccggggaatcgctagagttgcag
tgcatgttgaaagatgccgccgtgatcagttggactaaggatggggtgcacttggggccc
aacaataggacagtgcttattggggagtatctccagataaaaggtgccacacctagagac
tccggcctctatgcttgtactgcagctaggacggtagacagtgaaacttggtacttcatg
gtgaatgtcacagatgccatctcatctggagatgatgaggacgacacagatagctccgaa
gacgttgtcagtgagaacaggagcaaccagagagcaccgtactggaccaacaccgagaag
atggagaagcggctccacgctgtccctgccgccaacactgtgaagttccgctgtccggct
ggggggaatccaacgcccacaatgaggtggttaaaaaacgggaaggagtttaagcaggag
catcgcattggaggctataaggtacgaaaccagcactggagccttattatggaaagtgtg
gtcccgtcagacaaaggcaactacacctgcctggtggagaatgaatacgggtccatcaac
cacacctaccacctcgatgtcgttgaacggtcaccacaccggcccatcctccaagctgga
ctgcctgcaaatgcctccacggtggtcggaggggatgtggagtttgtctgcaaggtttac
agcgatgcccagccccacatccagtggatcaagcacgtggaaaagaacggcagtaaatac
gggcctgatgggctgccctacctcaaggtcctgaaggccgccggtgttaacaccacggac
aaagagattgaggttctctatattcggaatgtaacttttgaggatgctggggaatatacg
tgcttggcgggtaattctatcgggatatcctttcactctgcatggttgacagttctgcca
gcgcctgtgagagagaaggagatcacggcttccccagattatctggagatagctatttac
tgcataggggtcttcttaatcgcctgcatggtggtgacagtcatcttttgccgaatgaag
accacgaccaagaagccagacttcagcagccagccagctgtgcacaagctgaccaagcgc
atccccctgcggagacaggtaacagtttcggccgagtccagctcctccatgaactccaac
accccgctggtgaggataacaacgcgtctgtcctcaacagcggacaccccgatgctagca
ggggtctccgagtatgagttgccagaggatccaaagtgggaattccccagagataagctg
acgctgggcaaacccctgggggaaggttgcttcgggcaagtagtcatggctgaagcagtg
ggaatcgataaagacaaacccaaggaggcggtcaccgtggcagtgaagatgttgaaagat
gatgccacagagaaggacctgtctgatctggtatcagagatggagatgatgaagatgatt
gggaaacataagaacattatcaacctcctgggggcctgcacgcaggatggacctctctac
gtcatagttgaatatgcatcgaaaggcaacctccgggaatacctccgagcccggaggcca
cctggcatggagtactcctatgacattaaccgtgtccccgaggagcagatgaccttcaag
gacttggtgtcctgcacctaccagctggctagaggcatggagtacttggcttcccaaaaa
tgtatccatcgagatttggctgccagaaacgtgttggtaacagaaaacaatgtgatgaag
atagcagactttggcctggccagggatatcaacaacatagactactataaaaagaccaca
aatgggcgacttccagtcaagtggatggctcctgaagccctttttgatagagtttacact
catcagagcgatgtctggtccttcggggtgttaatgtgggagatctttactttagggggc
tcaccctacccagggattcccgtggaggaactttttaagctgctcaaagagggacacagg
atggacaagcccaccaactgcaccaatgaactgtacatgatgatgagggattgctggcat
gctgtaccctcacagagacccacattcaagcagttggtcgaagacttggatcgaattctg
actctcacaaccaatgaggaatacttggatctcacccagcctctcgaacagtattctcct
agttaccccgacacaaggagctcttgttcttcaggggacgattctgtgttttctccagac
cccatgccttatgaaccctgtctgcctcagtatccacacataaacggcagtgttaaaaca
tga

DBGET integrated database retrieval system