KEGG   Mus musculus (mouse): 17295Help
Entry
17295             CDS       T01002                                 

Gene name
Met, AI838057, HGF, HGFR, Par4, c-Met
Definition
(RefSeq) met proto-oncogene
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04360  Axon guidance
mmu04510  Focal adhesion
mmu04520  Adherens junction
mmu05100  Bacterial invasion of epithelial cells
mmu05144  Malaria
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05211  Renal cell carcinoma
mmu05218  Melanoma
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    17295 (Met)
   04015 Rap1 signaling pathway
    17295 (Met)
   04010 MAPK signaling pathway
    17295 (Met)
   04151 PI3K-Akt signaling pathway
    17295 (Met)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    17295 (Met)
   04520 Adherens junction
    17295 (Met)
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    17295 (Met)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    17295 (Met)
   05230 Central carbon metabolism in cancer
    17295 (Met)
   05202 Transcriptional misregulation in cancer
    17295 (Met)
   05206 MicroRNAs in cancer
    17295 (Met)
   05205 Proteoglycans in cancer
    17295 (Met)
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    17295 (Met)
   05226 Gastric cancer
    17295 (Met)
   05218 Melanoma
    17295 (Met)
   05211 Renal cell carcinoma
    17295 (Met)
  09171 Infectious diseases: Bacterial
   05100 Bacterial invasion of epithelial cells
    17295 (Met)
  09174 Infectious diseases: Parasitic
   05144 Malaria
    17295 (Met)
  09176 Drug resistance: Antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    17295 (Met)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    17295 (Met)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     17295 (Met)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  MET family
   17295 (Met)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Sema Pkinase TIG PSI Kinase-like Pkinase_fungal stn_TNFRSF12A PepSY_TM
Motif
Other DBs
NCBI-GeneID: 17295
NCBI-ProteinID: NP_032617
MGI: 96969
Ensembl: ENSMUSG00000009376
Vega: OTTMUSG00000024024
UniProt: F8VQL0 A4FUV6
Position
6 A2; 6 7.83 cM
AA seq 1379 aa AA seqDB search
MKAPTVLAPGILVLLLSLVQRSHGECKEALVKSEMNVNMKYQLPNFTAETPIQNVVLHGH
HIYLGATNYIYVLNDKDLQKVSEFKTGPVLEHPDCLPCRDCSSKANSSGGVWKDNINMAL
LVDTYYDDQLISCGSVNRGTCQRHVLPPDNSADIQSEVHCMFSPEEESGQCPDCVVSALG
AKVLLSEKDRFINFFVGNTINSSYPPGYSLHSISVRRLKETQDGFKFLTDQSYIDVLPEF
QDSYPIKYIHAFESNHFIYFLTVQKETLDAQTFHTRIIRFCSVDSGLHSYMEMPLECILT
EKRRKRSTREEVFNILQAAYVSKPGANLAKQIGASPSDDILFGVFAQSKPDSAEPVNRSA
VCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARSDEYRTEFT
TALQRVDLFMGRLNQVLLTSISTFIKGDLTIANLGTSEGRFMQVVLSRTAHLTPHVNFLL
DSHPVSPEVIVEHPSNQNGYTLVVTGKKITKIPLNGLGCGHFQSCSQCLSAPYFIQCGWC
HNQCVRFDECPSGTWTQEICLPAVYKVFPTSAPLEGGTVLTICGWDFGFRKNNKFDLRKT
KVLLGNESCTLTLSESTTNTLKCTVGPAMSEHFNVSVIISNSRETTQYSAFSYVDPVITS
ISPRYGPQAGGTLLTLTGKYLNSGNSRHISIGGKTCTLKSVSDSILECYTPAQTTSDEFP
VKLKIDLANRETSSFSYREDPVVYEIHPTKSFISGGSTITGIGKTLNSVSLPKLVIDVHE
VGVNYTVACQHRSNSEIICCTTPSLKQLGLQLPLKTKAFFLLDGILSKHFDLTYVHNPVF
EPFEKPVMISIGNENVVEIKGNNIDPEAVKGEVLKVGNQSCESLHWHSGAVLCTVPSDLL
KLNSELNIEWKQAVSSTVLGKVIVQPDQNFAGLIIGAVSISVVVLLLSGLFLWMRKRKHK
DLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGACR
QVQYPLTDLSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHFNE
VIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIEEVSQFLTEGIIMKDFSHPNVLSL
LGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKFVH
RDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKFTT
KSDVWSFGVLLWELMTRGAPPYPDVNTFDITIYLLQGRRLLQPEYCPDALYEVMLKCWHP
KAEMRPSFSELVSRISSIFSTFIGEHYVHVNATYVNVKCVAPYPSLLPSQDNIDGEGNT
NT seq 4140 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctcccaccgtgctggcacctggcattctggtgctgctgttgtccttggtgcag
aggagccatggggagtgcaaggaggccctagtgaagtctgagatgaacgtgaacatgaag
tatcagctccccaacttcacggcagaaacccccatccagaatgtcgtcctacacggccat
catatttatctcggagccacaaactacatttatgttttaaatgacaaagaccttcagaag
gtatccgaattcaagaccgggcccgtgttggaacacccagattgtttaccttgtcgggac
tgcagcagcaaagccaattcatcaggaggggtttggaaagacaacatcaacatggctctg
cttgttgacacatactatgatgatcaactcattagctgtggcagtgtcaacagagggact
tgccagcggcatgtccttcctcctgacaattctgctgacatccagtctgaggtccactgc
atgttctccccagaagaggagtcagggcagtgtcctgactgtgtagtgagtgccctcgga
gccaaagtcctcctgtcggaaaaggaccggttcatcaatttctttgtggggaatacgatc
aattcctcctatcctcctggttattcactgcattcgatatcggtgagacggctgaaggaa
acccaagatggttttaagtttttgacagaccagtcctatattgatgtcttaccagaattc
caagattcctaccccataaagtacatacatgccttcgaaagcaaccattttatttacttt
ctgactgtccaaaaggaaactctagatgctcagacttttcatacaagaataatcaggttc
tgttccgtagactctgggttgcactcctacatggaaatgcccctggaatgcatcctgaca
gaaaaaagaaggaagagatccacaagggaagaagtgtttaatatcctccaagccgcgtat
gtcagtaaaccaggggccaatcttgctaagcaaataggagctagcccttctgatgacatt
ctcttcggggtgtttgcacaaagcaagccagattctgctgaacctgtgaatcgatcagca
gtctgtgcattccccatcaaatatgtcaatgacttcttcaacaagattgtcaacaaaaac
aacgtgagatgtctccagcatttttacggacccaaccatgagcactgtttcaataggacc
ctgctgagaaactcttccggctgtgaagcgcgcagtgacgagtatcggacagagtttacc
acggctttgcagcgcgtcgacttattcatgggccggcttaaccaagtgctcctgacatcc
atctccaccttcatcaaaggtgacctcaccattgctaatctagggacgtcagaaggtcgc
ttcatgcaggtggtgctctctcgaacagcacacctcactcctcatgtgaacttcctcctg
gactcccatcctgtatctccagaagttattgttgagcatccatcaaatcaaaatggctat
acattggttgtcacaggaaagaagatcaccaagattccattgaatggcctgggctgtgga
catttccaatcctgcagtcagtgcctctctgccccttactttatacagtgtggctggtgc
cacaatcaatgtgtgcgttttgatgaatgccccagcggtacatggactcaagagatctgt
ctgccggcggtttataaggtgttccccaccagcgcgccccttgaaggaggaacagtgttg
accatatgtggctgggactttggattcaggaagaataataaatttgatttaaggaaaacc
aaagttctgcttggcaacgagagctgtaccttgaccttaagcgagagcacgacaaatacg
ttgaaatgcacagttggtcccgcgatgagtgagcacttcaatgtgtctgtaattatctca
aacagtcgagagacgacgcaatacagtgcattctcctatgtagatcctgtaataacaagc
atttctccgaggtacggccctcaggctggaggcaccttactcactcttactgggaaatac
ctcaacagtggcaattctagacacatttcaattggagggaaaacatgtactttaaaaagt
gtatcagatagtattcttgaatgctacaccccagcccaaactacctctgatgagtttcct
gtgaaattgaagattgacttggctaaccgagagaccagcagcttcagttaccgggaagac
cccgttgtctatgaaatccacccgaccaaatcttttattagtggtggaagcacaataacg
ggtattgggaagaccctgaactcggttagcctcccaaagctggtaatagatgtgcatgaa
gtgggtgtgaactacacagtggcatgtcagcatcgctcaaattcagagatcatctgctgc
actactccttcactgaaacagctgggcctgcaactccccctgaagaccaaagccttcttc
ctgttagacgggattctttccaaacactttgatctcacttatgtgcataatcctgtgttt
gagccttttgaaaagccagtaatgatctcaataggcaatgaaaatgtagtggaaattaag
ggaaacaatattgaccctgaagcagttaaaggtgaagtgttaaaagttggaaatcagagc
tgcgagagtctccactggcactctggagctgtgttgtgtacagtccccagtgacctgctc
aaactgaacagcgagctaaatatagagtggaagcaagcagtctcttcaactgttcttgga
aaagtgatcgttcaaccggatcagaattttgcaggattgatcattggtgcggtctcaata
tcagtagtagttttgttattatccgggctcttcctgtggatgagaaagagaaagcataaa
gatctgggcagtgaattagttcgctatgacgcaagagtacacactcctcatttggatagg
cttgtaagtgcccgaagtgtaagtccaactacagagatggtttcaaatgagtctgtagac
tacagagctacttttccagaagaccagtttcccaactcctctcagaatggagcatgcaga
caagtgcaataccctctgacagacctgtcccctatcctgacaagtggagactctgatata
tccagcccattactacaaaatactgttcacattgacctcagtgctctaaatccagagctg
gtccaagcagttcagcacgtagtgattggacccagcagcctgattgtgcatttcaatgaa
gtcataggaagagggcattttggctgtgtctatcatgggactttgctggacaatgacgga
aagaaaattcactgtgctgtgaaatccttaaatagaatcacagatatagaagaggtctcc
cagtttctgactgagggaatcatcatgaaagacttcagccatcccaatgttctctcactc
ttgggaatctgcctgaggagtgaagggtctcctctggtggtcctgccctatatgaagcat
ggagatctgcgaaatttcattcgaaacgagactcataatccaactgtgaaagatcttata
ggatttggccttcaagtagccaaaggcatgaaatatcttgccagcaaaaagtttgtccac
agagacttagctgcaagaaactgcatgttggatgaaaaattcactgtcaaggttgctgat
ttcggtcttgccagagacatgtacgataaagagtactatagtgtccacaacaagacgggt
gccaagctaccagtaaagtggatggctttagagagtctgcaaacgcagaagttcaccacc
aagtcagatgtgtggtcctttggtgtgctcctctgggagctcatgacgagaggagcccct
ccttatcccgacgtgaacacatttgatatcactatctacctgttgcaaggcagaagactc
ttgcaaccagaatactgtccagacgccttgtacgaagtgatgctaaaatgctggcacccc
aaagcggaaatgcgcccgtccttttccgaactggtctccaggatatcctcaatcttctcc
acgttcattggggaacactacgtccacgtgaacgctacttatgtgaatgtaaaatgtgtt
gctccatatccttctctgttgccatcccaagacaacattgatggcgaggggaacacatga

DBGET integrated database retrieval system