KEGG   Mus musculus (mouse): 18627Help
Entry
18627             CDS       T01002                                 

Gene name
Per2, mKIAA0347, mPer2
Definition
(RefSeq) period circadian clock 2
  KO
K02633  period circadian protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04710  Circadian rhythm
mmu04713  Circadian entrainment
mmu05168  Herpes simplex infection
mmu05202  Transcriptional misregulation in cancer
mmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    18627 (Per2)
   04713 Circadian entrainment
    18627 (Per2)
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    18627 (Per2)
  09162 Cancers: Specific types
   05221 Acute myeloid leukemia
    18627 (Per2)
  09172 Infectious diseases: Viral
   05168 Herpes simplex infection
    18627 (Per2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    18627 (Per2)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    18627 (Per2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Period_C PAS_3 PAS_11 PAS
Motif
Other DBs
NCBI-GeneID: 18627
NCBI-ProteinID: NP_035196
MGI: 1195265
Ensembl: ENSMUSG00000055866
Vega: OTTMUSG00000048493
UniProt: O54943 A0A0R4J0U3 Q3TW41 Q8C8R0
Structure
PDB: 

Position
1; 1 D
AA seq 1257 aa AA seqDB search
MNGYVDFSPSPTSPTKEPGAPQPTQAVLQEDVDMSSGSSGNENCSTGRDSQGSDCDDNGK
ELRMLVESSNTHPSPDDAFRLMMTEAEHNPSTSGCSSEQSAKADAHKELIRTLKELKVHL
PADKKAKGKASTLATLKYALRSVKQVKANEEYYQLLMSSESQPCSVDVPSYSMEQVEGIT
SEYIVKNADMFAVAVSLVSGKILYISNQVASIFHCKKDAFSDAKFVEFLAPHDVSVFHSY
TTPYKLPPWSVCSGLDSFTQECMEEKSFFCRVSVGKHHENEIRYQPFRMTPYLVKVQEQQ
GAESQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQAVDERAVPLLGYLPQDLI
ETPVLVQLHPSDRPLMLAIHKKILQAGGQPFDYSPIRFRTRNGEYITLDTSWSSFINPWS
RKISFIIGRHKVRVGPLNEDVFAASPCPEEKTPHPSVQELTEQIHRLLMQPVPHSGSSGY
GSLGSNGSHEHLMSQTSSSDSNGQEESHRRRSGIFKTSGKIQTKSHVSHESGGQKEASVA
EMQSSPPAQVKAVTTIERDSSGASLPKASFPEELAYKNQPPCSYQQISCLDSVIRYLESC
SEAATLKRKCEFPANIPSRKATVSPGLHSGEAARPSKVTSHTEVSAHLSSLTLPGKAESV
VSLTSQCSYSSTIVHVGDKKPQPELETVEDMASGPESLDGAAGGLSQEKGPLQKLGLTKE
VLAAHTQREEQGFLQRFREVSRLSALQAHCQNYLQERSRAQASDRGLRNTSGLESSWKKT
GKNRKLKSKRVKTRDSSESTGSGGPVSHRPPLMGLNATAWSPSDTSQSSCPSAPFPTAVP
AYPLPVFQAPGIVSTPGTVVAPPAATHTGFTMPVVPMGTQPEFAVQPLPFAAPLAPVMAF
MLPSYPFPPATPNLPQAFLPSQPHFPAHPTLASEITPASQAEFPSRTSTLRQPCACPVTP
PAGTVALGRASPPLFQSRGSSPLQLNLLQLEEAPEGSTGAAGTLGTTGTAASGLDCTSGT
SRDRQPKAPPTCNEPSDTQNSDAISTSSDLLNLLLGEDLCSATGSALSRSGASATSDSLG
SSSLGFGTSQSGAGSSDTSHTSKYFGSIDSSENNHKAKMIPDTEESEQFIKYVLQDPIWL
LMANTDDSIMMTYQLPSRDLQAVLKEDQEKLKLLQRSQPRFTEGQRRELREVHPWVHTGG
LPTAIDVTGCVYCESEEKGNICLPYEEDSPSPGLCDTSEAKEEEGEQLTGPRIEAQT
NT seq 3774 nt NT seq  +upstreamnt  +downstreamnt
atgaatggatacgtggacttctccccaagtcccaccagtcccaccaaggagccaggggca
cctcagcccacccaggctgtgctccaggaagacgtggacatgagcagtggctccagcgga
aacgagaactgctccacgggacgggactctcagggcagtgactgcgacgacaatgggaag
gagctgcggatgctcgtggaatcttccaacactcaccccagccctgatgatgccttcaga
ctcatgatgacagaggcagagcacaacccctccacgagcggctgcagtagtgagcagtct
gccaaagctgacgcacacaaagaactgataaggaccctgaaggagctgaaggtccacctc
cctgcagacaagaaggccaaggggaaggccagcacgctggcaaccttgaagtatgccctg
cggagcgtgaagcaggtgaaggctaatgaggagtactaccagctgctaatgtccagtgag
agccagccctgcagtgtggatgtgccttcctacagcatggagcaggttgagggcattacc
tccgagtatatcgtgaagaacgcggatatgtttgctgtggctgtgtccctggtttctggg
aagatcctgtacatctctaaccaagtggcctccatctttcactgtaagaaggacgccttc
agtgatgccaagtttgtggagttcctggctcctcatgacgtcagtgtgttccacagctac
accaccccttacaagcttccgccctggagtgtgtgcagcggcttagattctttcactcag
gagtgcatggaggagaaatcttttttctgccgtgtcagtgttgggaaacaccacgagaat
gagattcgctaccagcccttccgcatgacaccctacctggtcaaggtgcaagagcagcag
ggtgctgagagccagctctgctgcctgctgctggcagagagggtacactcgggctatgaa
gcgcctagaatccctcctgagaagaggatcttcacaacaacccacacaccaaactgcttg
ttccaggctgtggatgaaagggcggtccccctcctgggctatctacctcaggatctgatc
gagacgcctgtgctcgtgcagctccaccccagcgaccggcccttgatgctcgccatccac
aagaagatcctacaggccggtggacagcctttcgattattctcccattcgattccgcacc
cgcaacggggagtacatcacactggacactagctggtccagcttcatcaacccgtggagc
aggaagatatctttcatcattgggaggcacaaagtcagggtaggccctttgaatgaggat
gtgttcgcagcctccccgtgcccagaggagaagactccgcaccccagcgttcaggagctc
acagaacaaatccaccggctactgatgcagcctgtcccccacagcggctccagtggctat
gggagcctgggcagtaacggatcccacgaacacctcatgagccagacatcatccagcgac
agcaatggccaagaggagtctcaccggaggagatccggaatttttaaaaccagtggcaag
attcaaaccaaaagtcacgtttctcatgagtctggaggacagaaggaagcatctgttgca
gaaatgcaaagcagccccccagctcaggtgaaagctgtcaccaccatagaaagggacagc
tcaggggccagcctacccaaggccagcttcccagaggaactagcctataagaaccagcct
ccttgctcctaccagcagatcagctgcctggacagtgtcatcaggtacctggagagctgc
agcgaggcagccaccctgaaaaggaagtgcgagttcccagccaacatcccatcccggaag
gccacagtcagccccgggctgcactctggagaggcagcgcggccctccaaggtgaccagc
cacacagaggtcagtgctcacctgagctccctgacgctgccaggcaaggccgagagtgtg
gtgtccctcaccagccagtgcagctacagcagcaccatcgtgcatgtgggcgacaaaaag
ccacagcccgagctagagacggtagaagatatggccagtgggcccgagtccctggatggt
gcggccggcggcctcagccaagaaaaggggcctcttcagaagttgggcctcaccaaggaa
gttctggctgcacatacacagagagaggagcagggcttcctgcagaggttcagggaggtg
agcaggctcagtgccctgcaggctcactgccagaactatctccaggagcggtcccgagcc
caggcgagtgatcgaggactaagaaatacttctggactagagtcatcttggaaaaaaact
ggaaagaacaggaaactgaagtcaaaacgcgtcaagactcgggactcttctgagagcaca
gggtctggaggaccagtgtcccaccgacctcccctcatgggcctgaatgccacagcctgg
tcaccctccgacacatcccagtccagctgcccctctgcacccttccccaccgcagtgcca
gcttaccccctacctgtgttccaggcacccggaatagtatccacaccagggacggtggtg
gcgccacctgcagccacccacactggcttcaccatgcctgttgtgcctatgggcacccag
cctgaattcgcagtgcagcccctgccattcgctgcccctttggctcctgtcatggccttc
atgctgcccagctacccgttcccaccagcaaccccaaacctgcctcaggccttcctcccc
agccagcctcactttccagcccaccccacacttgcctccgaaataactcctgcctcccag
gctgagttccctagtcggacctcgacgctcagacagccgtgcgcttgcccagtcacccct
ccagccggcacagtggccctgggcagagcctccccaccgctcttccagtccagaggcagt
agtcccctacaacttaacctgcttcagctagaggaggcgcctgaaggcagcactggagcc
gcagggaccctggggaccacagggacagcagcttctggtctggactgcacatctggcaca
tctcgggatcggcagccaaaggcacctccaacatgcaacgagccctcagacactcagaac
agtgatgccatctccacgtcaagtgacctgctcaacctccttctgggcgaggacctctgc
tcggccactggctcagccctgtctagaagcggggcatccgccacctcagactctctgggc
tccagctcgctgggcttcggcacatcccaaagtggggcaggcagtagtgacacaagtcac
accagcaaatactttggaagcattgactcttcagagaataatcacaaagcaaaaatgatc
ccagacacggaggaaagcgagcagttcattaagtacgtcttgcaggaccccatctggctg
ctgatggccaacacagacgacagcatcatgatgacataccagctgccctcccgggatctc
caggcggtgttgaaggaggaccaggagaagctgaagctgctgcagaggtcccagccccgg
ttcacagagggccagaggcgagagctccgagaggttcatccgtgggtccacactgggggc
ctgcctacggccatcgatgtgacaggctgtgtttactgcgagagtgaggagaaaggcaac
atttgcctgccatatgaggaagacagtccttccccgggactctgtgatacctcagaagcc
aaagaggaggaaggtgaacagctgacaggccccaggatagaggcccagacgtaa

DBGET integrated database retrieval system