KEGG   Mycobacteroides abscessus subsp. massiliense GO 06: MYCMA_0206Help
Entry
MYCMA_0206        CDS       T02177                                 

Definition
(GenBank) exodeoxyribonuclease V subunit gamma
  KO
K03583  exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
mmv  Mycobacteroides abscessus subsp. massiliense GO 06
Pathway
mmv03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mmv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    MYCMA_0206
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmv03400]
    MYCMA_0206
Enzymes [BR:mmv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MYCMA_0206
DNA repair and recombination proteins [BR:mmv03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     MYCMA_0206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_V_gamma RecC_C
Motif
Other DBs
NCBI-ProteinID: AFN62380
Position
4306059..4309292
Genome map
AA seq 1077 aa AA seqDB search
MALHLRRAERTDMLADGLARLLAEPAPDPFAEELVLVPAKGIERWLSQRLSDRLGVCAGV
RFRSPRSLIAEITGTVDHDPWSPAALVWPLLAVIDENLDQSWAVPLASHLGAFETGEERE
LRQGRRYAVARRLAGLFASYARQRPELLVSWLDGDPAEPDLAWQPPLWRALVARVDAVPP
HVRHNQVRARLREAPSDLPPRISLFGHTRLPVTDVELLDALATHHDLYLWLPHPSDALWQ
TLASDRGPVPRREDIAHRSVRHPLLATLGRDVRELQRALPVPTSDEYLSGTTFSDSLLGW
LQSDLAADEVRPQGRALAAHDHTVQVHSCHGPARQIDVLREVLLGLLADDPTLEPRDILV
MCPDIETYAPLISARFGLGESVPGAHPAHQLRVRLADRALVQTNPLLTVAGQILSLASGR
ATASEVLNLAEATPVRMRFGFTDDDLDAITAWVREANIRWGFDPEHRAPYGVDFLHNTWR
FGIDRVLAGVALSEDAHAWLGATLPLDDVSSNRVELAGRFAEFVSQLHTTVTALSGTRPL
AEWLSILSTGIDALATDSEDWPRAQMLREFSEIQDAAVPVSLRLSDIRALLDRHLAGRPT
RANFRTGTLTVCTMVPMRSVPHRVVCLVGLDDGVFPRLGAVDGDDALARDPMTGERDIRS
EDRQLLLDAIGAATETLVLTYTGANEYSGQARPPAVPLAELLDTLDITTSRPVRDRIHIT
HPLQPFDIRNVTPGGVIPGHPFTFDGTALIAARAAAGARAERPPFICGPLPALDVTDVAL
TDLAAFFNHPIKGFFRALDYTLPWDVDGVSDDMPVEIDALEEWTVGDRLLADMLRGMTPT
DAQQAEWRRGTLPPGQLGWRRVSELRDRCAALAAETRGYQTDDSRAFDIDIDLGDGRRVT
GTVSPVFGERLVSVTYSRLDAKHLLQSWITLVALSAHDHQRDWSAVCIGRARRGPQPLVR
SLGRPTDPLGVLRDLVAIYDAGRREPLPLPLKTSYAWAQARRDRDDPELQAGYRWRSGNF
PGEDADPAVERAFGQGVWLRHLMQPLRPGEETEGETNRLGAYSARLWLPLLRAEHGA
NT seq 3234 nt NT seq  +upstreamnt  +downstreamnt
atggcacttcacctgcgccgggccgagcggaccgacatgctcgccgacgggctcgcccgg
ctgctggccgagcccgctccggatccctttgccgaggagttggtgctggtaccggcgaag
ggcatcgagcggtggctcagccagcggttatccgacaggctcggggtgtgtgcgggcgtg
cgatttcgcagcccgcgctcactgatcgccgagatcaccggaaccgtcgaccacgacccg
tggtcacccgctgcgctggtgtggccgctgctggcggtgatcgacgagaacctggaccag
tcctgggccgtcccgctggcctcgcacctcggggcgttcgagaccggcgaggaacgtgag
ctgcgccagggccgccgctacgcggtggcccggcgccttgcggggctgttcgcgtcctat
gcgcgtcagcgtccggagctgttggtctcctggctcgacggtgacccggcggaaccggat
ctggcgtggcagccgccgttgtggcgcgcgctggtggcgcgggtcgacgcggttcccccg
catgttcgacacaaccaggtccgtgctcgcctgcgcgaggcgccgtcggatctgccaccg
cgcatatccctgttcgggcatacgcggctccccgtcaccgatgtcgaactgctcgatgcc
ctggcgacgcatcacgacctgtacttgtggctaccgcaccccagcgatgcgctatggcag
acgttggcgagcgaccgcggcccggtcccgcggcgcgaggacatcgcgcatcgttcggtc
cgtcatccactactggccacgctgggacgcgatgtccgtgaattgcagcgcgccctgccc
gtaccaacgtcagatgaatatctgagtggcacaacattttcagactcgctgttgggttgg
ctgcagtccgacctggcggccgacgaggtgcgtccccagggccgggcgctcgcggcgcac
gatcatacggtgcaggtgcattcctgccacggcccggcacgtcagatcgatgtgctacgc
gaggtgctgctgggcctgcttgccgacgaccccacactggagccgcgggacatcctcgtc
atgtgcccggacatcgaaacctatgcgccgttgatatcggcccgttttggtctcggtgag
tcggtaccgggcgcccacccggcccatcagttacgggtccggctcgccgatcgtgctctg
gtgcaaaccaatccgctactgacggtggccgggcagatactgagtctggccagtgggcgc
gccaccgccagcgaggtcctgaacctcgccgaggcgacgccggtgcggatgcgtttcggc
ttcaccgacgacgacctggacgcgatcaccgcgtgggtgcgcgaggcgaacatccggtgg
ggtttcgacccggaacatcgcgcgccgtacggagtcgacttcctgcacaacacctggcgt
ttcggtatcgatcgggtacttgccggggtggcgctgtccgaggacgcgcatgcctggctg
ggtgccacgctgccgctcgacgatgtgagcagcaatcgggtcgagctggccggccgcttc
gcggagttcgtctctcagctccacaccacggtgaccgcgttgagcggcacccggcccttg
gccgagtggctgagcattctgtcgacgggtatcgatgctctcgccacggattcagaagat
tggccccgcgcccagatgttacgcgagttctccgagattcaggatgcggccgtgccggtc
tcgttgcggctcagcgatattcgcgcactcctggatcgccacctggcgggccgccccacg
cgcgccaactttcgcaccggcaccctcacggtctgcaccatggtgcccatgcggtcggtc
ccgcatcgggtcgtctgtctcgtcgggctcgacgacggcgtgttcccgcggctcggcgcc
gtcgacggagatgacgccctggcgcgcgacccgatgaccggtgaacgcgatatccgttcc
gaagatcgacagttgcttctggacgcgatcggcgccgctaccgaaaccctggtactcacc
tataccggagccaacgagtactcgggacaggcgcgtccccccgccgtaccgctggccgag
ttgctggacacgttggatatcacgacgtcgcggccggtccgtgatcggatccacatcacc
cacccgttgcagccgttcgatattcgcaatgtgacgcccggcggcgtgattcccgggcat
ccgttcacctttgatggcaccgcgctgatcgcggcccgcgccgccgcgggagcgcgggcc
gagcggccgccgttcatctgcggcccattgcccgccctcgatgtcaccgacgtggcattg
actgatctcgctgccttcttcaatcatcccatcaagggtttcttccgcgccctggactac
accctgccgtgggatgtggatggggtatccgacgacatgccggtcgagatcgacgccctc
gaagagtggacggtaggcgatcgcctactggccgacatgctgcgcggtatgacaccgacc
gatgcgcagcaggccgaatggcgccgtggcactttacctcccggacagctcggctggcgg
cgggtctccgagttgcgggaccgctgcgcggcgctggccgcggagaccaggggctaccaa
accgatgacagtcgagcctttgacatcgatatcgatctcggtgacgggcgccgcgtcacc
ggcaccgtgtccccggtgttcggtgaacggctggtgtcggtcacctattcgcggctcgac
gccaagcatctgctgcaatcgtggattacgttggtggcgttgagcgcccacgatcatcag
cgggactggtcggcggtatgcatcggccgcgcccgccgaggtccgcaaccgctggtacgc
agcctcggacgacccacggatccactgggcgtattgcgtgacctagtggccatctacgac
gcgggccgccgggagccgctgcccttgccgctgaagacctcctacgcgtgggcgcaggct
cgccgcgatcgtgatgaccccgagctgcaggccggataccgctggcgttccggcaacttt
ccgggcgaagacgcggaccctgccgtcgaacgtgccttcggccagggggtctggttgcgg
catctgatgcagccgctgcggcccggggaagagaccgagggggaaacgaaccgcctcggt
gcgtattccgcgcggttgtggttgccgttgctacgggcggagcacggcgcatga

DBGET integrated database retrieval system