KEGG   Mycobacteroides abscessus subsp. massiliense GO 06: MYCMA_0219Help
Entry
MYCMA_0219        CDS       T02177                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mmv  Mycobacteroides abscessus subsp. massiliense GO 06
Pathway
mmv00010  Glycolysis / Gluconeogenesis
mmv00620  Pyruvate metabolism
mmv00640  Propanoate metabolism
mmv00680  Methane metabolism
mmv01100  Metabolic pathways
mmv01110  Biosynthesis of secondary metabolites
mmv01120  Microbial metabolism in diverse environments
mmv01130  Biosynthesis of antibiotics
mmv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYCMA_0219
   00620 Pyruvate metabolism
    MYCMA_0219
   00640 Propanoate metabolism
    MYCMA_0219
  Energy metabolism
   00680 Methane metabolism
    MYCMA_0219
Enzymes [BR:mmv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MYCMA_0219
Lipid biosynthesis proteins [BR:mmv01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MYCMA_0219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AFN62392
Position
4282238..4284214
Genome map
AA seq 658 aa AA seqDB search
MTETSIEPDSYPPSPEFVATANATADLYQAAEEDRLGFWEQQAGRLHWDEPFRQVLDWSD
APFAKWFVGGKLNVAYNCVDRHVEAGNGDRVAIHWEGEPGDTRTITYAELLAKVSQAANY
LTELGLVSGDRVAIYMPMLPEAIVAMLACARLGLMHSVVFAGFSAAALRARIDDAQAKLV
ITSDGQWRRGTAAPLKSQVDEALGAAGPATSDLGGEPSSVEHVLVVRRTEIPVEWTEGRD
LWWHETVDKADTTHTAEPFDSEHPLFLLYTSGTTGKPKGIVHTSGGFLTQTSYTHFNIFD
LKPETDVYWCTADIGWVTGHTYIVYGPLSNGATQVVYEGTPTSPNEHRHFEIIEKYGVTI
YYIAPTLVRTFMKWGREIPFAHDLSSLRLLGSVGEPINPEAWRWYREVIGGNRTPIVDTW
WQTETGSAMISPLPGVTETKPGSAMRAVPGISAKIVDDEGNQLEPASGDEPVTGYLVLDK
PWPSMLRGIWGDPERFKETYWSRYAEQGWYFAGDGARYDSDGAIWVLGRIDDVMNISGHR
ISTAEVESALVGHDGVAEAAVVGASDETTGQAIVAFVILKASHTVEGDELVAHLKAQVSK
EISPIAKPREIHVVPELPKTRSGKIMRRLLRDVAEGRELGDTSTLVDPSVFEAIRASK
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaaccagcatcgagccggacagctatccgccgtcgccggaattcgtagcgaca
gcgaatgcgaccgccgacctctaccaggcggccgaggaagatcggctcgggttctgggag
cagcaggccggccgcctgcactgggacgagcccttcaggcaggttctcgactggtccgac
gcgcccttcgcgaagtggtttgtgggcggcaagctcaacgtcgcgtacaactgcgtcgac
cggcatgtagaggccggtaacggcgatcgggtcgccatccactgggagggcgaaccgggc
gacacccgcaccatcacctatgccgaactgctggctaaggtcagtcaggccgccaactac
ctgaccgaactcggcctggtatccggtgaccgggtggccatttacatgccgatgctgccc
gaggcgatcgtggcgatgctggcatgtgcgcgactgggtctgatgcacagcgtcgtcttc
gcgggattctccgcggcagcgctgcgcgcccgcatcgatgacgcacaggccaagctggtg
atcacctccgacggccaatggcgccgaggcaccgccgcccccttgaagagtcaggtagac
gaagccctgggagccgcggggccggcgacatccgacctaggcggcgagcccagttccgtc
gagcacgttctggtggtgcgccgcaccgagattccggtcgaatggaccgagggccgagac
ctgtggtggcacgagacggtcgacaaggccgataccacccacactgctgaacctttcgat
tccgagcatccgctgttcctgctgtacacctccggaaccaccggcaagcccaagggcatc
gtgcacacctcgggcggcttcctgacgcagacgtcatacacccacttcaacatcttcgat
ctcaagcccgagaccgatgtgtactggtgcacggccgatatcggctgggttaccggccac
acctacatcgtctacggcccgctctccaacggcgccacccaggtggtatacgagggaacg
cccacctccccgaacgaacatcgtcacttcgagatcatcgaaaagtacggcgtcaccatc
tattacatcgcgcccaccctggtcaggacattcatgaaatggggccgcgagatcccattc
gcgcatgatctgtccagcctgcggctgctcggcagtgtcggcgagccgatcaaccccgag
gcctggcgctggtaccgcgaggtcatcggcggcaaccgcacaccgatcgtggacacctgg
tggcagacggagaccggctcggccatgatttctccgctgcccggcgtcaccgagaccaaa
cccggttccgcgatgcgcgcggtccccggcatttccgcgaaaatcgttgatgacgaagga
aatcagctggagcccgcgagcggcgatgaaccggttaccgggtacttggtgctggacaag
ccgtggccgtcgatgctgcgcgggatctggggcgacccggagcggttcaaggagacgtac
tggtcccgctacgccgagcagggctggtacttcgccggcgacggcgcacgctacgacagc
gacggtgccatctgggtcctggggcgcatcgacgatgtcatgaacatctccgggcaccgg
atctccaccgccgaggtggagtccgcactggtcggacacgacggggtcgccgaggcggcc
gtcgtcggcgcctccgatgaaacgaccgggcaggcgatcgtggccttcgtgatcctgaag
gccagccacaccgtcgaaggcgacgaactcgtcgcacacctgaaagctcaggtgtccaaa
gagatttcgccgatcgccaagccgcgagagattcacgtggtgccggagctacccaaaaca
cgcagcggcaagatcatgcggcggctgctgcgtgatgtggccgagggacgcgaactgggc
gacacctcaacgctggtggatccgagcgtcttcgaggcgatcagggccagcaagtag

DBGET integrated database retrieval system