KEGG   Mycobacteroides abscessus subsp. massiliense GO 06: MYCMA_04600Help
Entry
MYCMA_04600       CDS       T02177                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mmv  Mycobacteroides abscessus subsp. massiliense GO 06
Pathway
mmv00071  Fatty acid degradation
mmv00072  Synthesis and degradation of ketone bodies
mmv00280  Valine, leucine and isoleucine degradation
mmv00310  Lysine degradation
mmv00362  Benzoate degradation
mmv00380  Tryptophan metabolism
mmv00620  Pyruvate metabolism
mmv00630  Glyoxylate and dicarboxylate metabolism
mmv00640  Propanoate metabolism
mmv00650  Butanoate metabolism
mmv00900  Terpenoid backbone biosynthesis
mmv01100  Metabolic pathways
mmv01110  Biosynthesis of secondary metabolites
mmv01120  Microbial metabolism in diverse environments
mmv01130  Biosynthesis of antibiotics
mmv01200  Carbon metabolism
mmv01212  Fatty acid metabolism
mmv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mmv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MYCMA_04600
   00630 Glyoxylate and dicarboxylate metabolism
    MYCMA_04600
   00640 Propanoate metabolism
    MYCMA_04600
   00650 Butanoate metabolism
    MYCMA_04600
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MYCMA_04600
   00072 Synthesis and degradation of ketone bodies
    MYCMA_04600
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MYCMA_04600
   00310 Lysine degradation
    MYCMA_04600
   00380 Tryptophan metabolism
    MYCMA_04600
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MYCMA_04600
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MYCMA_04600
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MYCMA_04600
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmv04147]
    MYCMA_04600
Enzymes [BR:mmv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MYCMA_04600
Exosome [BR:mmv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MYCMA_04600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Peptidase_M22 DUF4191
Motif
Other DBs
NCBI-ProteinID: AIC71319
Position
complement(714135..715325)
Genome map
AA seq 396 aa AA seqDB search
MGASKNLAAVIGTGQTKYVAKRQDVSMNGLVREAIDRAMTDAGVDWDDIDAVVVGKAPDF
FEGVMMPELFMADAIGATGKPMIRVHTAGSVGGSTGVVAASLVQSGKYRRVLALAWEKQS
ESNAMWALSIPVPFSVPVGAGAGGYFAPHVRAYIQRSKAPLDTGAMVAVKDRLNAAKNPL
AHLHQPDITVEKVMSSPMLWDPIRFDETCPSSDGACAIVVGDEDTADRRIKEGHAVAWVH
ATALRTEPLDYTGRDRVNPQAGRDAAAALWKDAGITSPIDEIDVAEIYVPFSWFEPMWLE
NLGFAAEGEGWKLTQAGETAIGGKIPVNASGGVLSSNPIGASGLIRFAEAAIQVMGKAGD
HQVPGAKKALGHAYGGGSQYYSMWVVGSEKPAGKEQ
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcatcgaagaacctggctgccgtcatcggcactgggcagacaaagtacgtcgcc
aagcggcaagacgtctccatgaatggtcttgtccgcgaggccatcgatcgcgccatgacg
gacgccggtgtcgattgggacgatatcgatgctgtcgtcgtcggtaaggcccccgacttt
ttcgagggcgtcatgatgcccgagctcttcatggcggatgcgatcggtgcgaccggaaaa
ccgatgatccgggtgcacaccgcggggtccgtcggaggatcgacaggcgtggtcgcggcc
agcctcgtgcagtcgggcaagtaccgccgggttctggcactcgcctgggagaagcagtcc
gagtcgaatgccatgtgggcgttgtcgattcccgtaccgttctcggttccggtgggcgcg
ggcgcgggcggatactttgccccccatgtgcgcgcatacatccagcggtccaaagcgccc
ctggacaccggcgccatggtggccgtaaaggaccggctcaacgccgccaagaacccgctg
gcacatctgcatcagcccgatatcaccgtcgagaaggtgatgtcctcccccatgctgtgg
gatcccatccgtttcgatgagacctgcccatcctcggacggcgcctgtgcgatcgtcgta
ggcgacgaggacaccgcggaccggcgtatcaaggaggggcatgcggtcgcctgggtgcat
gccaccgcgttgcgcaccgagccgctcgactacaccggccgcgaccgggtgaacccgcaa
gccgggcgcgatgccgcggccgcactgtggaaggacgccggaatcaccagccccatcgac
gagatcgacgtcgcggaaatctacgtgccgttctcctggttcgaaccgatgtggctggag
aatctgggattcgcggccgagggcgagggctggaagctcacccaggccggcgagaccgcg
atcgggggcaagattcccgtcaacgcgtccggcggcgtgctctcctcgaatccgattggc
gcctcgggccttatccgattcgccgaggctgccattcaggtaatgggcaaggccggtgat
catcaggtaccgggcgccaagaaggcactgggccacgcctacggcggcggctcgcagtac
tactcgatgtgggtggtcggatccgaaaagcccgcaggaaaggagcagtaa

DBGET integrated database retrieval system