KEGG   Mycobacteroides abscessus subsp. massiliense GO 06: MYCMA_0560Help
Entry
MYCMA_0560        CDS       T02177                                 

Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mmv  Mycobacteroides abscessus subsp. massiliense GO 06
Pathway
mmv00020  Citrate cycle (TCA cycle)
mmv00640  Propanoate metabolism
mmv00660  C5-Branched dibasic acid metabolism
mmv01100  Metabolic pathways
mmv01110  Biosynthesis of secondary metabolites
mmv01120  Microbial metabolism in diverse environments
mmv01130  Biosynthesis of antibiotics
mmv01200  Carbon metabolism
Module
mmv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MYCMA_0560
   00640 Propanoate metabolism
    MYCMA_0560
   00660 C5-Branched dibasic acid metabolism
    MYCMA_0560
Enzymes [BR:mmv01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MYCMA_0560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AFN62725
Position
complement(3702260..3703429)
Genome map
AA seq 389 aa AA seqDB search
MDLFEYQAKELFAKHNVPTTPGRVTTTAEDAKAIAEEIGKPVMIKAQVKVGGRGKAGGVK
YAATPDDAFTHAQNILGLDIKGHIVKKILVAEASDIAEEYYISFLLDRANRTYLAMCSVE
GGVEIEVTAEENPDALAKVPVDAVKGVDLALAREIAEKGKLPAEVLDSAAVTIQKLWEVF
VGEDATLVEVNPLVRTPDNQILALDGKVTLDGNADFRQPGHAEFEDKDATDPLELKAKEH
DLNYVKLDGQVGIIGNGAGLVMSTLDVVAYAGENHNGVKPANFLDIGGGASAEVMAAGLD
VILGDSQVKSVFVNVFGGITACDAVANGIVGALKTLGDTASKPLVVRLDGNKVEEGRAIL
AEFNHPLVIQAETMDAGADKAAALAAASN
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggatttattcgagtaccaggccaaggagctgttcgctaagcacaacgtgccgacgacg
ccgggccgggttaccaccaccgccgaggatgccaaggcgatcgccgaagaaatcggcaag
ccggtgatgatcaaggctcaggtcaaggttggtggacgtggcaaggccggtggtgtgaag
tacgccgccacccccgatgacgcatttactcatgcacagaacatcctgggcctggacatc
aagggccacatcgtcaagaagatcctcgtcgccgaggccagcgatatcgccgaggagtac
tacatctccttcctgctggaccgcgccaaccgcacctacctggccatgtgctcggtcgag
ggcggtgtcgagatcgaggtaaccgccgaggagaaccccgacgcactggccaaggtgccc
gttgatgccgtcaagggtgtcgacctggcgctggctcgtgagattgccgagaagggcaag
ttgcccgccgaggtgctggactccgccgcggtgaccatccagaagctgtgggaggtcttc
gtcggcgaggatgccaccctggtggaggtcaacccgctggtgcgtacccccgacaatcaa
atcctggcgctggacggcaaggtcaccctggacggcaacgccgatttccgtcagcccggc
catgccgagttcgaggacaaggacgccaccgatccgctggaactcaaggccaaggagcac
gacctcaactacgtcaagctcgatggtcaggtcggcatcatcggcaacggcgcaggtctg
gtcatgtccaccctggatgtcgtcgcgtacgcgggcgagaaccacaacggcgtgaagccc
gccaacttcctggatatcggtggtggcgcctcggccgaggtgatggctgccggtcttgat
gtcatcctgggtgactcgcaggtcaagagcgtttttgtgaacgtgttcggtggcatcacc
gcatgtgacgcggtggccaacggcatcgtcggcgccctgaagaccctcggtgacacggcc
agcaagccgttggtggttcgtctcgacggcaacaaggtcgaagaaggacgggcgattctg
gccgagttcaatcatccgctggtgatccaggccgagaccatggacgccggtgccgacaag
gcggccgccctggcggccgcgtccaactag

DBGET integrated database retrieval system