KEGG   Mycobacteroides abscessus subsp. massiliense GO 06: MYCMA_1433Help
Entry
MYCMA_1433        CDS       T02177                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mmv  Mycobacteroides abscessus subsp. massiliense GO 06
Pathway
mmv00260  Glycine, serine and threonine metabolism
mmv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mmv01100  Metabolic pathways
mmv01110  Biosynthesis of secondary metabolites
mmv01130  Biosynthesis of antibiotics
mmv01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MYCMA_1433
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MYCMA_1433
Enzymes [BR:mmv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MYCMA_1433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Gmad2
Motif
Other DBs
NCBI-ProteinID: AFN63574
Position
2266744..2268003
Genome map
AA seq 419 aa AA seqDB search
MKNTGLPQMSTAIAEPTAHDPDARGHFGPYGGRYVAEALMAVIEEVTAAYEKIRSDRSFL
DELDRLQTHYVGRPSPLYEAKRLSAHAGGARIFLKREDLNHTGSHKINNVLGQVLLAKKM
GKTRVIAETGAGQHGVATATACALLGLECVIYMGAVDTARQALNVARMRLLGSTVVSVES
GSKTLKDAINDAMRDWVTNAHNTYYCFGTAAGPHPFPVMVRDFQRIIGMEARAQVLDQVG
RLPDAAVACVGGGSNAIGLFHAFIDDPAVRLVGYEAAGDGVETGRHAATFTGGTPGAFQG
SYSYLLQDDDGQTIESHSISAGLDYPGVGPEHAWLRESGRADYRPITDSEAMDAFLLLSR
AEGIIPAIESAHAVAGALKLGGELGEGAVIVVSLSGRGDKDVETAAKWFDLLDKDGSQS
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacaccggcctgccgcagatgagcactgcgatcgctgagcccaccgcgcacgat
cctgacgcccggggccatttcggtccgtacggtggccgctacgtggccgaggcactgatg
gccgtcatcgaggaagtaacggcggcctacgaaaagatcaggtccgaccggtcattcctc
gacgagctcgatcgcttgcagactcactacgtgggacgcccatcgccgctgtacgaagcg
aaacgacttagcgctcacgccggcggcgcacgtatctttctcaaacgagaagacctgaac
cacactggttctcacaagatcaacaatgttctcggtcaagttctgttggccaagaagatg
ggcaagacccgtgtgatcgccgagaccggtgccgggcagcacggtgttgccaccgccacc
gcatgcgcgctgctgggtctggaatgcgtgatctacatgggcgcggtcgacaccgcacgg
caagccctcaatgtcgcgcggatgcggctgttgggatcgaccgtggtgtcggtggaatcg
gggtcgaaaaccctgaaggacgcgataaacgacgcgatgcgtgactgggtaaccaacgcg
cacaacacctattactgcttcggtacggccgctggaccgcacccctttccggtgatggtc
cgcgattttcagcgcatcatcggcatggaggcgcgagcgcaagttcttgatcaagtgggc
agattgccggacgcggccgtggcctgcgtcggcggcggctcgaacgccatcggcttgttc
catgcctttatcgatgacccggcagtgcgcttggtgggctacgaggctgcgggtgacggc
gtcgaaaccggaaggcacgcagccacattcaccggtggtaccccgggtgctttccaaggc
tcctactcttatctgctccaggacgacgacggtcagaccatcgaatctcattcgatctca
gccggtctggactacccgggagttggacccgagcacgcctggctgcgcgagagcgggcgc
gcggactaccgcccgatcaccgacagcgaggccatggatgccttcctgttgctttcgcgc
gccgagggcatcatccccgccatcgaatcggcgcatgccgtggccggcgcactcaaactc
ggcggcgagttgggcgagggtgcggtcatcgtggtgagcctgtcgggtcgcggcgacaag
gatgtcgagaccgccgccaagtggttcgacctactggacaaggacggcagccagtcatga

DBGET integrated database retrieval system