KEGG   Mycobacteroides abscessus subsp. massiliense GO 06: MYCMA_1647Help
Entry
MYCMA_1647        CDS       T02177                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
mmv  Mycobacteroides abscessus subsp. massiliense GO 06
Pathway
mmv00860  Porphyrin and chlorophyll metabolism
mmv01100  Metabolic pathways
mmv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MYCMA_1647
Enzymes [BR:mmv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     MYCMA_1647
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     MYCMA_1647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 NAD_binding_9 DAO Pyr_redox_2 Trp_halogenase Thi4
Motif
Other DBs
NCBI-ProteinID: AFN63784
Position
1896612..1897988
Genome map
AA seq 458 aa AA seqDB search
MTPQPSGSPSIAIVGGGISGLTAAYRLRRELGDDARISLYDPAGQLGGILRTITLGEHRI
DIGAEAFITRRPEVLDLLDELGLAGRTLDTTGARPLIYAGGGLHPLPARTVNGIPASASS
VVGLVDEETVARIDSEPQRDMHWTVGAEPTVADLVALRFGPQVVARLVDPLLGGVYAGSA
ATTGLRTAAPGIARALDEGAGSLLAAARQALPPISASGIFGAIDGGYAVLVEELWSRARA
EHVQVAVTGIERDGAGWAVTGEGGLTDAVDAVIVAVPAPRAAAILEAVAPESAAAARTIP
VASSVVVALTLPGDAPIPANSGVLVASGEALHTKAITFSTSKWGLRGRSTQVVRLSYGRF
GDTVARATTDEQLRHWAVADLEAVLGAGIVPVNSAVARWIDAMPQYGPGHAEVVDAIRSG
LPSGIAVAGSYLDGIGVPACVASASQAAQASVARWRHG
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
gtgacgccgcagccgtcgggttctccctccattgccattgtggggggcggtatttcgggc
ctgacggcggcatatcggctccgccgcgaacttggtgatgacgcccgcatcagcctctac
gacccggccgggcagttgggcggcatcctgcgcaccatcaccctgggtgaacaccggatc
gacatcggcgccgaggccttcatcacgcggcgcccggaggttctcgacctgctggacgaa
ctggggctggccggccgcacgctcgataccaccggcgcacggccgctgatctacgccggc
ggcggcttgcatccgctgcccgcgagaacggtgaacggcattccggcttcggcgtcgtcg
gtggtggggctcgtcgacgaggaaaccgttgcccgcatcgacagcgaaccccagcgcgat
atgcattggaccgtcggagccgaaccgaccgtcgccgaccttgtcgccctgcgattcggg
ccgcaggtcgtcgcccggctggtcgatccgttactcggtggcgtgtatgcgggctcggcc
gcgacgacgggtctgcgcacggcagcgcccggcattgcccgggcactcgacgagggagca
ggcagtctgttggccgcggcccggcaggcgttgccaccgatatccgccagcggcattttc
ggtgctattgacggcggctacgcggtgctggtggaggagctctggagccgcgcgcgggcc
gaacatgtgcaggtagcggtgaccggcatcgaacgtgacggcgcgggctgggcggtcacc
ggcgagggcggactgacggatgccgtcgatgccgtcatcgtggcggtgccggcaccccgt
gcggccgcaattcttgaggcggtggcccctgaatcggcggccgccgcacgcaccatcccg
gtggcctcgtcggtcgtcgtggcgctgacgctgcccggcgacgccccgatacccgccaat
tcgggggtgctcgtcgcgtcgggagaagccttgcataccaaggccataacgttctcgacc
agtaagtgggggttgcgcgggcggagtacccaggtggtgcgactttcctatgggcgcttc
ggtgacacggtggcgcgcgctaccaccgacgagcagctgcggcactgggccgttgccgat
ctggaggcggtgttgggcgccggcatcgtcccggtcaactcggcggtggcccgctggatc
gatgccatgccgcagtacgggccgggccacgctgaagtcgtcgacgccatccgttccgga
ttgccgtccggaatcgcggtggccggctcgtacctggatgggataggggtgccggcttgt
gtggcctccgcctctcaagccgcgcaggccagcgtggcacgatggaggcatggctag

DBGET integrated database retrieval system