KEGG   Mycobacteroides abscessus subsp. massiliense GO 06: MYCMA_1733Help
Entry
MYCMA_1733        CDS       T02177                                 

Definition
(GenBank) hypothetical protein
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mmv  Mycobacteroides abscessus subsp. massiliense GO 06
Pathway
mmv00860  Porphyrin and chlorophyll metabolism
mmv01100  Metabolic pathways
mmv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MYCMA_1733
Enzymes [BR:mmv01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     MYCMA_1733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 AAA_5 VWA Mg_chelatase MCM VWA_CoxE Sigma54_activat AAA AAA_3 VWA_3 AAA_16
Motif
Other DBs
NCBI-ProteinID: AFN63868
Position
1736287..1738155
Genome map
AA seq 622 aa AA seqDB search
MASATAGYPLSAIVGHDRLRLALVLSAVRPDIGGVLIRGEKGTAKSTAVRALASVLGSVD
GARLVELPIGATEDRVVGSLDLQKVLRDGEHAFSPGLLARADGGVLYVDEVNLLHDHLVD
VVLDAAAMGRVHVERDGVSHSYDARFVLIGTMNPEEGELRPQLLDRFGFAVDIHASRDVE
VRAEVIRRRLAYEADPAGFVSRYAAEEAELAVRIADARQLLARVVLPDAELRRIATLCAA
FDVDGMRADLVVARAAIAHAAWRGAETVSEPDIRVAAELALPHRRRRDPFDEPGLDPDQL
DQAMRDSAPPQDQDGEDPDPDPDGPGGGAPESAPDPAKASDSQQDSASAAGSSRPSPAPS
ATFRAKTLRVPGVGMGAPGKRSAARNRAGKVIAPSSDEGFGVHVIGTLMSAASRVTEPGR
LPRPVPTDLQWAIREGREGNLVIFVVDASGSMAARQKMSAVSGATLSLLRDAYQRRDKVA
VITFRGQDAAMLLAPTSSTHIAGRRLQRFDTGGKTPLAQGLLAARDLVARERGRDPHRRA
LVVVLTDGRATGGRDPLGRTRRASALLRAEQVACVVIDCETSFVRMDLAVTLAQQLDAPV
IQLDHLNADRLAGVVRGATAAA
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atggctagcgccacagccggatacccgctgagtgcgatcgtcggccacgatcggctgcga
ttggccctggtgctttcggcggtgcggcccgacatcggcggtgtgctcatccgtggcgag
aagggcacggccaaatcgactgcggtgcgcgccctggcgtcggtactgggttcagtcgac
ggggcacgattggtggagctgcccatcggtgccaccgaggatcgggtcgtgggctccctg
gacctacagaaggtattgcgcgacggcgaacacgctttctccccggggcttttggcgcgt
gccgacggtggcgttctgtacgtggacgaggtcaacctactgcacgatcacctagtcgat
gtggtcctggacgcggcggcgatgggccgggtacatgtggagcgcgacggcgtatctcat
tcgtacgatgcgagattcgtgttgatcggcaccatgaatcccgaggagggggagctgcgt
ccccagctgctcgaccgtttcggattcgcggtggacattcatgcctcccgtgatgtcgag
gtgcgggccgaagtcatccggcggcggcttgcctatgaggcagatcccgcgggtttcgtc
tcgaggtacgcagcggaggaggccgagctggcggtccgtattgccgatgctcggcagcta
cttgctcgagttgtcctgcccgacgccgaattacggcgcatagcaactctgtgcgctgcc
tttgacgtggacgggatgcgtgccgatctggtggtggcgcgcgctgcgatcgcccacgcg
gcgtggcgcggcgccgagaccgtcagtgagcccgatatccgagtggcagcggagctggca
ctgccacatcggcgccgccgggatccgttcgatgaaccgggtctggatccagatcagctc
gaccaggcgatgcgcgacagcgcgccgccgcaggatcaggatggggaagatcctgacccc
gacccggacggcccgggcggtggtgcacccgagtctgccccggatcctgcgaaagcgagt
gattcacagcaggattcggcatccgcggctgggtcgtcgcggcccagtccggcgccttcg
gcgacctttcgtgccaagactttgcgggttccgggagttggtatgggagccccggggaag
cgctccgcggcccgcaaccgcgccggcaaggtgattgcgccgagttcggacgaggggttc
ggggtgcatgtgattggcaccttgatgtccgccgcgagccgggtgaccgaacctgggcgg
ctacccagaccggtgcctaccgatctgcagtgggcgataagggaaggccgcgaaggcaac
ctggtgatctttgtggtcgatgcctcggggtccatggccgcgcgccagaagatgtcggca
gtcagcggcgcgaccttgtccctgctgcgtgatgcctatcagcgccgcgacaaggtcgcg
gtcatcacgtttcgcgggcaggatgccgccatgctgctggcgcccactagctcgactcat
atcgcgggccgtaggctgcagcggttcgataccggcggcaagactcccttggcgcagggt
ctgctggccgcacgtgacttggtggcgcgcgagcgtggacgtgacccgcaccggcgtgct
ttggtggtggtgctcaccgatgggcgtgctaccggtggtcgggaccccttggggcgcaca
cgtcgcgcttcggcactgctgcgtgccgaacaggtcgcctgcgtggtgatcgactgtgag
acatctttcgtgcggatggatttggctgtcactctggcgcagcagctcgacgcgccggtg
atccagcttgaccatctgaacgctgaccggctcgccggagtggtgcgcggcgcgactgcc
gctgcgtga

DBGET integrated database retrieval system