KEGG   Marinomonas sp. MWYL1: Mmwyl1_0233
Entry
Mmwyl1_0233       CDS       T00567                                 
Name
(GenBank) regulatory protein LacI
Organism
mmw  Marinomonas sp. MWYL1
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 HTH_3 HTH_23 HTH_Tnp_ISL3 HTH_Crp_2 DUF1887 HTH_31 HTH_35
Other DBs
NCBI-ProteinID: ABR69175
UniProt: A6VRU6
Position
complement(271753..272802)
AA seq 349 aa
MTTIYDVAEAAGVSPKTVSRVLNNDVPVGEKTRKKVEAAIAALGYVPSTAARSMRSNKSG
LIGLVTGAISHFSDTSNAPTGLPDLFIVQGIQKVMQASGKTLLIADTGDSAASVPHLIRT
FQEHRVEGLIYVANYHKQIDLPIASKSIHTVLANCFDTNHTTSVVPNDQMGQKSLVDKII
KEGHSRIAYLTLDPSMVATHQRLEGYQQALHENDIAYDPELVLCADTLDLLDNEKLIIDA
IDHLLSLACPPTAICCGNDKMALKLYGILRVKGIRIPEQISIAGYDNYLAITEGLYPALT
TVHLPYQEIGQEAARQLLKLIDGKDQKAPNSAITIVDSPVIWRQSILKI
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgacgaccatttacgatgttgcagaagccgctggagtctctccaaagacagtttctcgc
gtattaaataatgatgttcctgtcggagaaaagacccgtaagaaagtagaagctgccatt
gcagctcttggctatgttccaagtactgcggcgagatctatgcgatcaaataaatcgggg
cttatcggcttggtcacaggtgctatttctcatttttctgacacatctaatgcacccact
ggtttgcctgatttatttattgttcagggtattcaaaaggtaatgcaagcctctggtaaa
acgttattaatcgccgatacaggagattctgctgcatcggtgcctcatttaattcggaca
tttcaagaacatcgtgttgaagggcttatttatgtggcgaattatcataagcaaatagat
ttacctatcgccagtaaaagcatccacactgtactagcaaactgctttgatacaaaccac
acaacatccgtggttccaaatgaccaaatgggtcaaaaatctttagtggataaaatcata
aaagaaggtcactccagaattgcatacttgaccttagacccatccatggtcgcaacgcat
caacgacttgaaggataccaacaggccttacatgaaaacgacattgcgtacgatcctgag
ttagttttatgtgcagacacactagatctactagacaacgaaaaattgatcatcgacgcg
attgatcacttgctttcattggcctgtccgcctactgctatttgttgtggtaacgacaaa
atggcactcaagctttatggtattttaagagtcaagggtatccgtatacctgagcaaata
tccattgctggttatgataactatcttgcgattactgaaggtttgtacccagcattaacc
acggtacatctgccttatcaagaaattgggcaagaagcggcacgacaacttttaaagttg
attgatggtaaagaccaaaaagcaccaaactcagcaataaccatcgttgatagtcctgtt
atttggcggcaatcaattcttaagatttaa

DBGET integrated database retrieval system