KEGG   Marinomonas sp. MWYL1: Mmwyl1_0020Help
Entry
Mmwyl1_0020       CDS       T00567                                 

Definition
(GenBank) 3'(2'),5'-bisphosphate nucleotidase
  KO
K01082  3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
mmw00920  Sulfur metabolism
mmw01100  Metabolic pathways
mmw01120  Microbial metabolism in diverse environments
mmw01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Mmwyl1_0020
Enzymes [BR:mmw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Mmwyl1_0020
Transfer RNA biogenesis [BR:mmw03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Mmwyl1_0020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P FBPase DUF5339
Motif
Other DBs
NCBI-ProteinID: ABR68963
UniProt: A6VR84
Position
23010..23870
Genome map
AA seq 286 aa AA seqDB search
MQDISKHPIFQALQKIIHDAADVIMDIYQRADLGIEQKPDDSPVTAADLAAHKVILAGLQ
ALTPDIPVLSEESSEERQVTFEERSKWPVLWIVDPLDGTKEFIKRNGEFSINIALVENGA
PILGVVYIPTTTEGYFGVTKVWQGLPVGAFKWQGDEYESINVREPREPIIAMTSRSHGPA
LPASLKNKLKQSYEQVRELPKGSSIKGCRIAEGIADLHLRRGPTSEWDTAAQQAIIEAAG
GMLVTPDGKPFRYNQRETLLNGHFFVSGAELAPYVMNWYLENEEEE
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacattagtaaacacccaatttttcaagctctccaaaaaataatacacgatgcc
gccgatgtgatcatggatatttatcaacgtgcagatttaggcattgaacaaaagccggat
gatagtcctgtgaccgctgctgatctcgctgcgcacaaagtgattctagcaggtttgcaa
gcacttacacccgatattcctgttctttcagaagagagctctgaagaacgccaggtgacg
tttgaagagcgttctaaatggccagtgttatggattgttgatccgcttgatggcacgaaa
gaattcatcaagcgtaatggcgaattcagtattaatatcgccttggttgaaaacggcgcg
cccattctaggtgtggtgtatataccgaccacaaccgaaggctattttggagtgaccaaa
gtctggcaagggttgccagtcggtgcgtttaaatggcaaggtgatgaatacgaaagcatc
aatgttcgtgaaccacgcgaacctattattgccatgacgagtcgcagccatggccctgcc
cttccagcttcgctaaaaaacaaattaaagcaaagttacgagcaagtgagagagttacca
aaaggcagctcaatcaaaggctgtcgaattgctgaagggattgctgacttgcatttgcgt
cgaggcccgacaagtgaatgggatacggccgctcagcaagccatcatcgaagccgctggc
ggaatgctcgtcacaccggatggaaaaccatttcgttacaaccaaagagaaaccctactc
aatggtcacttctttgtatcgggtgctgaactcgcaccgtatgtgatgaactggtatctc
gaaaacgaggaagaagagtaa

DBGET integrated database retrieval system