KEGG   Marinomonas sp. MWYL1: Mmwyl1_0237Help
Entry
Mmwyl1_0237       CDS       T00567                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mmw  Marinomonas sp. MWYL1
Pathway
mmw00010  Glycolysis / Gluconeogenesis
mmw00071  Fatty acid degradation
mmw00350  Tyrosine metabolism
mmw00625  Chloroalkane and chloroalkene degradation
mmw00626  Naphthalene degradation
mmw01100  Metabolic pathways
mmw01110  Biosynthesis of secondary metabolites
mmw01120  Microbial metabolism in diverse environments
mmw01130  Biosynthesis of antibiotics
mmw01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mmw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mmwyl1_0237
  Lipid metabolism
   00071 Fatty acid degradation
    Mmwyl1_0237
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mmwyl1_0237
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mmwyl1_0237
   00626 Naphthalene degradation
    Mmwyl1_0237
Enzymes [BR:mmw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mmwyl1_0237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ABR69179
UniProt: A6VRV0
Position
complement(276099..277109)
Genome map
AA seq 336 aa AA seqDB search
MKAAVASKFGAILKIEDVVKPKIEPHQVLVKIHACGVCHTDLHACHGDWPVKPTLPFIPG
HEGVGEIVEVGSAVKHLALGDRVGIPWLYSACGHCEYCLTGNENLCLSQQNAGYSVDGGY
AEYCAAHAEYVVKVPEGLGYVEAAPLFCAGVTTYKALKVSGAKPGDWVALFGVGGLGHLA
VQYAVAMGFRVVAVDTGSAKRELAMSLGAEYFFDFKTDDVVKEILDTTSGVHATVCTAVS
KAGFRQSYDVVRRGGKCVLVGLPPEDMPLPIFNTVLNGVSVVGSIVGTRKDLEECLEFAA
RGKVKAIIAEKSLDDINEIFADMEKGEITGRIVMTL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctgtagccagtaagtttggtgccattctaaaaattgaggatgttgttaaa
cccaagattgaaccacatcaagttctcgtcaaaattcatgcttgcggtgtgtgccatacg
gatttacatgcttgtcatggagattggcctgttaaaccgacacttccctttattccaggt
catgaaggtgttggtgagatagtcgaagtcggcagtgcagtaaagcatttagccttggga
gatcgtgtcggtattccttggctgtacagtgcctgcggacattgtgaatattgtttaaca
ggtaacgaaaacttgtgtctttcacaacaaaatgcaggttactccgtcgatggcggttac
gccgaatattgcgcagctcatgctgaatacgtcgttaaagttccagaaggtttaggttat
gttgaagcggcacctttattctgtgccggtgtaactacttacaaagcgctcaaagtgtcc
ggtgccaagccaggcgattgggtagctctatttggtgttggcggtctaggccatttagcc
gtgcaatacgccgttgctatgggctttcgagtagttgctgtcgatacaggctcagccaaa
cgtgagctggcaatgtcattaggtgcggaatatttctttgatttcaaaactgacgatgtt
gttaaagagattttagacacaacctcaggtgttcatgccaccgtttgtactgctgtcagc
aaagcgggcttcagacagagttatgacgtggttcgacgtggtggtaaatgtgtcttggtt
ggtttgccaccagaagacatgccattgcctatttttaacaccgtcctcaatggcgtcagt
gtcgttggctccatcgtcggtactcgtaaagatctggaagagtgcttggagtttgccgca
cgcggcaaggtaaaagcgattatcgctgaaaaatccctagacgatattaatgagatcttc
gctgatatggaaaaaggtgaaattacaggccgtattgtaatgaccttgtaa

DBGET integrated database retrieval system