KEGG   Marinomonas sp. MWYL1: Mmwyl1_0355
Entry
Mmwyl1_0355       CDS       T00567                                 

Definition
(GenBank) alkyl hydroperoxide reductase/Thiol specific antioxidant/Mal allergen
  KO
K24119  NADH-dependent peroxiredoxin subunit C [EC:1.11.1.26]
Organism
mmw  Marinomonas sp. MWYL1
Brite
KEGG Orthology (KO) [BR:mmw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Mmwyl1_0355
Enzymes [BR:mmw01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.26  NADH-dependent peroxiredoxin
     Mmwyl1_0355
SSDB
Motif
Pfam: AhpC-TSA Redoxin 1-cysPrx_C SCO1-SenC
Other DBs
NCBI-ProteinID: ABR69293
UniProt: A6VS64
Position
complement(411264..411821)
AA seq 185 aa
MINTQIKPFNATAFKNGEFVEISEKDVLGKWAVFFFYPADFTFVCPTELGDVADNYAELQ
SRGVEVFSVSTDTHFTHKAWHASSETIGKIQYYMVGDQTGNITNNFGVMREGQGLADRAT
FLIDPQGTIQAMEITAEGIGRDAQDLLRKVKAAQYVAAHPGEVCPAKWKEGEATLTPSLD
LVGKI
NT seq 558 nt   +upstreamnt  +downstreamnt
atgatcaacactcaaatcaaaccattcaacgcaacagctttcaaaaacggcgaattcgta
gagatttctgaaaaagacgtgctaggcaaatgggctgtattcttcttctacccagctgac
ttcactttcgtttgcccaacagaacttggcgatgttgctgacaactatgctgaactacaa
tctcgcggcgtagaagtattctctgtttctacagacactcacttcactcacaaagcatgg
cacgcaagctctgaaacaatcggcaaaatccagtactacatggttggcgaccaaacaggc
aacatcactaacaacttcggtgtgatgcgtgaaggccaaggtcttgcagaccgcgcgact
ttcttgatcgacccacaaggtactatccaagcgatggaaatcactgcagaaggtattggt
cgtgatgctcaagacctacttcgcaaagtaaaagcagcgcaatacgttgccgctcaccca
ggtgaagtatgcccagctaaatggaaagaaggtgaagcaacattgacgccttctctagac
ctagttggcaaaatctaa

DBGET integrated database retrieval system