KEGG   Marinomonas sp. MWYL1: Mmwyl1_1183
Entry
Mmwyl1_1183       CDS       T00567                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
mmw  Marinomonas sp. MWYL1
Pathway
mmw03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:mmw00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Mmwyl1_1183
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mmw02044]
    Mmwyl1_1183
Secretion system [BR:mmw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Mmwyl1_1183
SSDB
Motif
Pfam: Phage_GPD Phage_base_V DUF2345 Phage_Mu_Gp45
Other DBs
NCBI-ProteinID: ABR70112
UniProt: A6VUI3
Position
1319447..1321531
AA seq 694 aa
MATLTFTLALDGMEDNTLLVREYQGHESLSDSLLKDGSPCYGFRYQLALASRQSDLSADT
IVDKNAELRVFRNGELIQRVHGIVRHFEKGDTGHHFTYYGLTLVPALERLSLRHNSRIFQ
KQTAQDIISQLLNEMGITEHLFDTQRTPLEREFCVQYRESDLDFVHRLAAEEGWVYYFTH
EEGKHQLHFADQSQLLPKHPTPIPYNVLSGGGSDDQYIATLTHRTQSLPSQAVLKDYSFK
KPDYRFLHQQDGENLDYQLPNYEHYDAPGRFKDDVTGKAFSRIRLEYLRRSARTLVGESN
HAAIQAGLKITIEGHSEDSINQEWLPVSVEHHGTQPQVLEEEGQSGSTNYSNTFTFIPAT
TNWQATPQPKPSVDGPMMAIVVGPEGEEIFCDEHGRVKLHFPWDRYSEANDHSSCWVRVS
QGWAGNQHGMMAIPRIGSEVIVSFLNGDPDQPIVTGRTFNAKNTPPYLLPDHKTKTVWRS
DTHQGEGFNEISFEDQVDNEKVYVHAQKDMETDVLNDRITHIGHDQHGQIDNDRFTQIGG
ENGTGNDHLTIKGESRHKIDKDQSISIDGNLQQKVGKIAILEAGEEIHIKSGDKTVIEAG
AEITLAAGGSFVKIDGGGVHLVGSVINLNSGGSPSAGSGFSGKLPISPLAEELPVSNEKV
EEKSAPPTTQKSTLVMAAEEGNPICEECQAAANT
NT seq 2085 nt   +upstreamnt  +downstreamnt
atggctacattgacgtttacactggcactcgacggcatggaagacaacactctgcttgtc
cgagaataccaagggcacgaatcgctctccgattccctgctaaaagacggctcgccttgt
tatggcttccgttaccaattggccctcgccagccgtcaatcggatctgtctgctgatacc
atcgtcgataaaaacgccgagctgcgcgtgtttcgtaacggcgaactgattcaacgagtg
cacggcattgttcgtcattttgaaaaaggcgacaccggccaccactttacctactacggc
ttaaccttggttccagcattggaacgcttatctttacgtcacaacagccgtatcttccaa
aagcaaaccgcgcaagacatcatcagccaactgctgaatgaaatgggcatcaccgaacac
ttgtttgatacccaacgtacaccgcttgaacgtgagttctgtgtccagtatcgtgaaagt
gacttagactttgtccaccgtttggcggccgaagaaggctgggtctactacttcacccac
gaagaaggcaaacaccaactgcactttgcggatcaaagccaactactgcccaaacaccca
accccgattccgtacaacgtcttatcgggtggcggctcagacgatcaatacatcgccacc
ctgacacaccgtacacaaagcttgcctagccaagcggtgctcaaagactacagcttcaaa
aaaccggactaccgcttcttgcaccaacaagacggcgagaacctagactaccaactgcca
aactacgaacactacgatgcccctgggcgcttcaaagacgacgtcacaggcaaagccttt
tcacgcatccgtctagaatacctacgccgcagtgcgcgaaccttagtaggagaaagcaac
cacgccgccatccaagcgggcctaaaaatcaccatcgaaggccacagcgaagacagcatc
aaccaagaatggttgcccgtctcggttgaacatcacggcacccaaccgcaagtcttggaa
gaagaaggccaatcaggcagcacaaactacagcaatacatttaccttcatccccgccacc
accaactggcaagcgacaccgcaacccaaacccagtgtcgatggccccatgatggccatt
gtggtggggcccgaaggggaagaaatcttctgtgacgaacacggacgagtcaaactgcac
ttcccgtgggaccgctacagcgaagccaacgaccatagctcctgctgggtacgtgtctcc
caaggctgggctggcaaccaacacggcatgatggcgattccacgaatcggcagcgaagtc
attgtcagctttttaaatggcgacccagatcaaccgatcgtgaccggacgcacctttaac
gccaaaaacaccccgccgtaccttttgcctgaccataaaaccaaaaccgtgtggcgcagc
gatactcaccaaggcgaaggcttcaacgagatcagttttgaggatcaagtcgacaacgaa
aaagtctatgtccacgcgcaaaaagacatggaaaccgatgtgctcaacgaccgcatcacc
cacatcggccacgaccaacacggacaaatcgacaacgaccgcttcacccaaatcggtggt
gaaaacggcacaggcaatgaccacctgaccatcaaaggtgaaagtcgtcataagatagat
aaagaccaatccatcagtattgatgggaacttacagcaaaaggtcggaaaaattgccata
ttagaggcaggtgaagaaatacacatcaagagcggtgacaaaaccgtgattgaagcagga
gcagaaatcacccttgccgcaggcggcagcttcgtcaaaattgacggcggcggtgtccac
ctagtcggctctgttatcaacctgaactctggcggtagcccaagtgcgggtagtgggttt
tcagggaagttgcctatatctccactggctgaagaactgcctgtttctaatgagaaagtg
gaagaaaaaagcgcgcctccgactacacagaagtccacacttgttatggctgctgaggaa
ggtaatccaatatgtgaagagtgtcaggcggcagcgaacacatag

DBGET integrated database retrieval system